(data stored in ACNUC7421 zone)

EMBL: CP000529.PE530

CP000529.PE530       Location/Qualifiers
FT   CDS_pept        complement(565874..566455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0537"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   sal:Sala_0677 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35857"
FT                   /db_xref="GOA:A1VJM9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJM9"
FT                   /protein_id="ABM35857.1"
FT                   /translation="MECGLPVLRLLVQQRALRAPFPGRAAATRHGRGDGRFDLLPGASS
FT                   FGRRPQNQRPAGHRHHARGPELPKIHAVCDALGNPLRFVLTPGQRHDSKPVPELLDGLQ
FT                   AKAPLADKAYDSDKIVQAAEKRGMQVIIPSRVNREKQRVLDKHRYKTRHLIENLFQRMK
FT                   AFRRVATRFDKLDIRSLGFVHIAGIMKWLH"
     atggaatgtg gtttaccagt gctacgccta ctggtgcagc aaagggcact tcgagcgcct        60
     tttccagggc gtgcagcagc aacccgacat ggaagaggtg atggtcgatt cgacctgctg       120
     ccgggcgcat caagcttcgg caggcgcccg caaaaccagc ggcccgcagg ccatcggcat       180
     cacgcgcggg gacctgaact acccaaaatc cacgccgtct gcgacgccct gggcaacccg       240
     ctgcgctttg tgctgacccc gggacagcgt cacgactcca aacccgtgcc cgaactgctc       300
     gatgggctgc aggccaaggc ccctctggcg gacaaagcct atgacagcga caagatcgtc       360
     caggcggcag aaaagcgtgg catgcaggtc atcatcccct ccagggtcaa ccgcgaaaag       420
     cagcgtgtcc tggacaagca ccgctacaag acgcggcacc tgattgaaaa cctcttccag       480
     cgcatgaagg cctttcgccg tgtggcgacc cgctttgaca agctcgacat ccgatctctg       540
     ggctttgtac acatcgccgg catcatgaaa tggctccact ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page