(data stored in ACNUC7421 zone)

EMBL: CP000529.PE531

CP000529.PE531       Location/Qualifiers
FT   CDS_pept        566895..567371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0538"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: bxe:Bxe_B1556
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35858"
FT                   /db_xref="GOA:A1VJN0"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJN0"
FT                   /protein_id="ABM35858.1"
FT                   /translation="MAMASETTELVLPLALDVAREDAREAGLSYAGGVPPAVAWQLFST
FT                   GHALLVDVRSGEERKFVGHVPQSLHVPWASGTSLTRNPRFVRELEAKTGGKDAVLLLLC
FT                   RSGKRSALAAEAAAKAGFTQVYNVLEGFEGEIDEQQHRGAADGWRFHGLPWVQD"
     atggcgatgg cctctgaaac aactgaactg gttttgcctt tagcgcttga tgttgcacgg        60
     gaagacgcgc gggaagccgg cttgtcttat gcgggcgggg tgcctccggc cgtggcgtgg       120
     caactgtttt ctaccggcca tgcgctgttg gtggatgttc gctcgggcga agagcgcaag       180
     tttgtcggcc atgtgccgca aagcctgcat gtgccctggg ccagcggcac cagcctgacg       240
     cgcaatccgc gcttcgtgcg cgaacttgaa gcgaaaaccg gcggcaagga tgcggtgctg       300
     cttttgctgt gccgcagcgg caagcgttct gcgttggccg cagaggccgc agccaaggcc       360
     ggtttcacgc aggtttacaa cgtgctcgaa ggctttgaag gcgaaattga cgaacagcaa       420
     catcgcggcg cggccgacgg ctggcgtttt cacggtctgc cttgggtgca agactga          477
//

If you have problems or comments...

PBIL Back to PBIL home page