(data stored in ACNUC7421 zone)

EMBL: CP000529.PE533

CP000529.PE533       Location/Qualifiers
FT   CDS_pept        568346..568618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0540"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   bpm:BURPS1710b_A0364 possible transcriptional regulator,
FT                   XRE family, cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35860"
FT                   /db_xref="GOA:A1VJN2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJN2"
FT                   /protein_id="ABM35860.1"
FT                   /translation="MRPTLVECFGIALRQSREARNWSQEQLAEHSNLNRSYVGEIERGS
FT                   AIASLATVEKLALALGISPSALVGRGEAVSQANVVRGIRLMAIAC"
     gtgaggccca cgctggttga gtgtttcggc attgcccttc gtcagtcgcg cgaggctagg        60
     aactggtcgc aggaacaact cgctgagcac tccaacctca accgctccta tgtcggcgag       120
     attgaacggg gcagcgcgat tgcatcgctg gcgacggtcg aaaaactcgc tctggccctg       180
     ggcatcagtc cgtctgcgct ggtcggtcgc ggcgaggcgg tgagccaggc caatgtggtt       240
     cgagggatca ggttgatggc tatagcatgt tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page