(data stored in ACNUC7421 zone)

EMBL: CP000529.PE535

CP000529.PE535       Location/Qualifiers
FT   CDS_pept        570177..571058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1553 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35862"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJN4"
FT                   /protein_id="ABM35862.1"
FT                   /translation="MLANATKTTAQLETISPRWLTHLLQWVPVEAGIYRLNKVKNPESI
FT                   KVKCTAREQEGQLPRTFVDYEENPREFFLNAVSTVLDVHTRISDLYSSPHDQIKEQLRL
FT                   TIETIKENQESELINNPDYGLLSQVSEEQRIFPLTGAPTPDDLDELLTKVWKEPAFFLT
FT                   HPLAIAAFGREATRRGTPPPTVSLFGSQFITWRGIPLIPSDKVPVADGKSKILLLRVGD
FT                   KRQGVVGLFQPGLTGEQGPGLSVRFMGINNHAIASYLISLYCSLAVLTTDALAVLDDVE
FT                   IGKYHDYADTYK"
     gtgctagcca atgccaccaa gaccacggcg cagctcgaaa ccatctcgcc acgctggctc        60
     acccacctgc tgcaatgggt gccagtcgag gccggtatct atcgcctcaa caaggtcaag       120
     aatcccgagt cgatcaaggt caaatgcacg gcgcgtgagc aagaaggcca gttgccgcgc       180
     acctttgtgg actacgagga aaatccgcgc gaatttttcc tcaacgccgt cagcaccgtg       240
     ctcgacgtgc atacgcgcat ctccgacctc tacagcagcc cgcacgacca gatcaaggag       300
     cagcttcgcc tgacgattga aaccatcaag gaaaaccagg aaagcgagct gatcaacaac       360
     cccgactacg gcctgctttc ccaggtgtcc gaagaacagc gaatttttcc attgacaggc       420
     gccccgacgc cagacgacct ggatgaactg ctgaccaaag tgtggaagga gccggcattt       480
     ttcctgaccc acccgctggc cattgccgcc ttcgggcgcg aagcgacccg gcgcggaacg       540
     ccgccgccaa cggtcagcct gttcggctct cagttcatca cctggcgcgg cattcccttg       600
     attccttccg ataaggtgcc ggtggccgac ggcaagagca aaatcctgct gctgcgcgtg       660
     ggcgacaagc gccagggcgt ggtcggcctg ttccagccgg gtctgacggg cgagcagggg       720
     ccgggcctgt cggtgcgctt catgggcatc aacaaccacg ccatcgcgtc ctacctgatc       780
     tcgctgtact gctcgctggc cgtgctgacc accgacgcgc tggccgtgct cgacgatgtc       840
     gagatcggca agtaccacga ttacgccgac acctacaaat aa                          882
//

If you have problems or comments...

PBIL Back to PBIL home page