(data stored in ACNUC7421 zone)

EMBL: CP000529.PE54

CP000529.PE54        Location/Qualifiers
FT   CDS_pept        55153..55944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35381"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIA3"
FT                   /protein_id="ABM35381.1"
FT                   /translation="MAGALLSALSGAAAAMPCGAPALGALAGVERSQWEEFDAQGKSLV
FT                   RERGTLQVAGLQALGRCGAVDWSAQWTRSQGQRGYDGITSTQAPLQTQSQLRAQALGIA
FT                   AWLPVSGSWAVGSQLGYRQVRRDIASVGNVLGYPERFDYLQAALGVRYQAALGERVRLS
FT                   ASGWLGGGPGGHVKVDLPRADPVTLPLGSSRLLALGLELDGGASAQPGWSWRAGVLYRR
FT                   EQTGAGDAQALTRNGVTVGAALQPRFVQRHLGATAVLAYRF"
     gtggctggcg cgctgctgtc cgccctgtcg ggcgccgccg ccgccatgcc gtgcggcgcg        60
     ccggccctgg gggcgctggc gggtgtcgag cgcagccaat gggaagagtt cgatgcgcag       120
     ggcaagtccc tggtgcgcga gcgtggaacg ctccaggtcg cgggtttgca ggccttgggg       180
     cgctgcggcg cggtggactg gtcggcgcaa tggacgcgca gccagggcca gcgcggctac       240
     gacggcatca ccagcaccca ggcgcccttg caaacgcaaa gccagctgcg ggcgcaggcc       300
     ctgggcatcg ccgcctggct gccggtgagc gggagctggg ccgtgggctc gcaactcggc       360
     taccgccagg tccggcgcga cattgccagc gtgggcaatg tgctcggtta tccggagcgc       420
     tttgactacc tgcaggccgc gctcggcgtg cgctaccagg ctgcgctggg cgagcgggtg       480
     cgcctgagcg cttcgggctg gctgggcggc gggcctggcg gccacgtcaa ggtcgatttg       540
     ccgcgtgccg acccggtgac gctgccgctc ggaagcagcc gcctgctggc cttgggcctg       600
     gagctggacg gcggcgcatc agcccagccc ggctggtcgt ggcgggctgg cgtgctgtac       660
     cggcgcgagc agacgggcgc cggtgatgcc caggccctca cccgcaacgg cgtgaccgtg       720
     ggcgcggcct tgcagccccg cttcgtgcag cggcacctgg gcgcgacggc cgtgctggct       780
     taccgcttct ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page