(data stored in ACNUC7421 zone)

EMBL: CP000529.PE541

CP000529.PE541       Location/Qualifiers
FT   CDS_pept        577720..578931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0548"
FT                   /product="long-chain-fatty-acid--CoA ligase-related
FT                   protein"
FT                   /note="KEGG: long-chain-fatty-acid--CoA ligase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35868"
FT                   /db_xref="GOA:A1VJP0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJP0"
FT                   /protein_id="ABM35868.1"
FT                   /translation="MTQTVNAASAAPATLPHWLLCQSHQQAGRIALRHKRLGVWQQRSW
FT                   RQAADEVHRLATALRASGFAEGSTLAILSRPRPEALLAALAAQWLGGVAALLDPLEAAA
FT                   GQIALLRALQPQAVFAEGLQEIERLQTSALTSGLVLYADGRGVTSPNPAGLALADYAQL
FT                   ALRETDCPWPVQAHAERTAFAFYRHAASGQIEQQRITHAELLQQGRRLVLAEKLGADEE
FT                   ALAARAFAASGQARYLLAPWLIAGFCLNFPENLATRDNDRRELGPTLVAGTLETYTRLH
FT                   ELVQSRLPQPGSVQRRLVDWALTAQPGAARRVLGEWLVRRPLRDVIGFTRTRAPLLVGE
FT                   PLSNNAQAFFAALGIEVRAWPDPAQWHSPAVAPAVPVPPTAPATPSLTTRQPGGWNPHG
FT                   AQAA"
     atgactcaga ccgtcaacgc cgcatcagca gcgcctgcca cgctgccgca ctggctgctg        60
     tgccagtcgc atcagcaggc cgggcgcatt gccctgcgcc acaagcgcct gggcgtgtgg       120
     cagcagcgct cctggcgtca ggcagctgac gaggttcacc gtctggccac ggcgctgcgg       180
     gccagcggtt ttgccgaggg ttcgacgctg gcgatactga gccggccgcg tcccgaagcc       240
     ctgctggcgg cgttggccgc ccagtggctg ggcggcgtgg cggcgctgct ggacccgctg       300
     gaagcggcgg ccgggcagat tgcgctgctg cgcgccttgc aaccccaggc ggtttttgcc       360
     gaaggactgc aggagatcga acgtctgcag accagtgcgc tgacgtcagg gctggtgttg       420
     tatgccgatg gacgcggtgt gaccagcccg aacccggcag gccttgcgct ggcagactat       480
     gcccaactgg cactgcgcga gaccgactgc ccctggccgg tgcaagcgca tgccgagcgc       540
     acggcttttg ctttttacag gcatgccgcc agcggccaga ttgagcagca gcgcatcacc       600
     catgccgagc tgctgcagca aggacggcgc ctggtgctgg ccgaaaagct gggtgcggat       660
     gaagaagcac tggccgcacg cgcttttgcc gccagtggtc aggcccgcta cctgttggcg       720
     ccgtggctga tagccggctt ctgcctgaat ttccccgaga acctggccac ccgcgacaac       780
     gatcggcgcg aactggggcc gacgctggtg gccggcactc ttgaaaccta tacgcgcctg       840
     catgaactgg tgcagtcccg cctgccgcag ccgggcagcg tgcagcggcg cctggtggac       900
     tgggcgctga ccgcgcagcc gggcgcagcg cgcagggtgc tgggcgaatg gctggtgcgc       960
     cgcccgctgc gcgacgtgat cggtttcacc cgaacccgtg cgccgctgct tgtgggcgag      1020
     cccttgtcca acaatgcgca ggctttcttt gccgcgctgg gcatcgaggt gcgcgcctgg      1080
     ccagatccgg cgcagtggca cagcccggcc gtcgcgccag ccgtaccagt cccgcccact      1140
     gcgccagcca cgccatcctt gacaacacgg cagcccggcg gctggaaccc tcacggcgca      1200
     caggccgcct ga                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page