(data stored in ACNUC7421 zone)

EMBL: CP000529.PE543

CP000529.PE543       Location/Qualifiers
FT   CDS_pept        579765..580646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0550"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   psp:PSPPH_2369 branched-chain amino acid ABC transporter,
FT                   permease protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35870"
FT                   /db_xref="GOA:A1VJP2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJP2"
FT                   /protein_id="ABM35870.1"
FT                   /translation="MEFFFEVLIGGLLAGVMYSLVAIGFVLIYKASGVFNFAQGSMVLF
FT                   AALTFVSLHERGMPFWLAFAVTLAAMVAIALLVERLVLRPLVNRSPITLFMATLGLSYM
FT                   IEGAAQALWGAQVHGLELGISDEPLALGGVLLSQFDLFAAGTAAVLVTALSLLFSKTRI
FT                   GLSLRAVADDPLAALAVGIRLQRIWAVVWAVAGFVGLVAGLLWGARLGVQFSLSLVVLK
FT                   ALPVLIIGGFSSIGGAIVGGLIIGASEKLAEIYLGPVIGGGLENWFPYVLALLFLLVRP
FT                   AGLFGERAIERV"
     atggaatttt tctttgaagt gctgatcggc gggctgctgg cgggggtgat gtactcgctc        60
     gtggctatcg gctttgtgct gatttacaag gcttcgggcg tgttcaattt cgcgcaaggc       120
     tcgatggtgc tgtttgcggc gctgaccttt gtcagcctgc acgagcgcgg catgccgttc       180
     tggctggcgt tcgcggtcac gctggcggcg atggtggcga tagccctgct ggtcgagcgc       240
     ctggtgctgc gcccgctggt caaccgctcg cccatcaccc tgttcatggc gacgctgggc       300
     ctgtcctaca tgatcgaggg cgcggcccag gccttgtggg gcgcgcaggt ccacgggctg       360
     gagctgggca tcagcgacga gccgctggcg ctgggcggcg tgctgctgtc gcagtttgac       420
     ttgttcgcgg cgggcacggc ggcggtgctg gtcacggcgc tgtcgctgct gttcagcaag       480
     acgcgcatcg gcctgtcgct gcgcgccgtg gccgacgacc cgctggccgc gctggctgtc       540
     ggcattcgcc tgcagcgcat ctgggcggtc gtgtgggcgg tggccggttt tgtcggactg       600
     gtggccgggc tgctctgggg cgcgcggctg ggcgtgcagt tttcgctctc gctggtggtg       660
     ctcaaggcgc tgccggtgct gatcattggc ggcttctcgt cgataggcgg cgccatcgtc       720
     ggcggcctga tcatcggcgc gtcggaaaag ctggccgaaa tctacctcgg cccggtcatt       780
     ggtggcggcc tggagaactg gtttccctat gtgctggcgc tgctgttttt gctggtgcgc       840
     ccggcaggcc tctttggcga acgcgccatc gagcgggtct ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page