(data stored in ACNUC7421 zone)

EMBL: CP000529.PE544

CP000529.PE544       Location/Qualifiers
FT   CDS_pept        580659..581726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0551"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   branched-chain amino acid ABC transporter, permease
FT                   protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35871"
FT                   /db_xref="GOA:A1VJP3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJP3"
FT                   /protein_id="ABM35871.1"
FT                   /translation="MLYNEAGQFSISYAGERRLFRLRQDRRALALLLAFAFVIVPFVGN
FT                   DYWFSAILIPFLVLSLAGLGLNLLTGYAGQLSLGSAAFMAVGAFAAYNFGLRLPGLPLL
FT                   ACLFLGGVTAALVAVVFGLPSLRIKGFYLIVSTLAAQFFVSWALTKFGWFSNDNASGVI
FT                   SAPPLTIFGVDFSAPVGRYLLTLSVVAALFWLGKNLVRSELGRNWMAVRDMDTAAAVIG
FT                   IPLLKTKLLAFALSGFFLGIAGSLWAFTYLGTVEPHGFDLNRSFQVLFIIILSGLGSIL
FT                   GNFLGAAFMVLFPLLLSNLAGALPVGLIDPGQLENLQKFIFGALIIAFLIKEPEGLARL
FT                   WQRFRERVRLWPLRY"
     atgctttaca acgaagccgg ccagttcagc atttcctacg cgggcgagag gcgccttttc        60
     cgcttgcgcc aggaccgccg tgcgctggcg ctgctgctgg cctttgcctt tgtcatcgtg       120
     cccttcgtgg gcaatgacta ctggttcagc gccatcctga ttccctttct ggtgctgtcg       180
     ctggccggtc tgggcctgaa cttgctgacg ggttacgcgg gccagctctc gctcgggtcg       240
     gcggctttca tggcggtcgg tgcgtttgcc gcctacaact tcgggctgcg cctgccgggc       300
     ctgccgctgc tggcctgcct gtttctgggc ggcgtgacgg cggcgctggt ggccgtggtg       360
     tttggcctgc ccagcctgcg catcaagggc ttttacctga ttgtctccac gctggcggcg       420
     cagttcttcg tgtcgtgggc gctgacgaaa ttcggctggt tttccaacga caacgcttcg       480
     ggcgtcatca gcgcgccgcc gctgaccatt ttcggcgtcg atttcagcgc gcccgtgggt       540
     cgctacctgc tcacactgag cgtggtggcg gcgctgttct ggctgggcaa gaacctggtg       600
     cgcagcgaac tgggccgaaa ctggatggcg gtgcgcgaca tggacacggc cgccgccgtc       660
     atcggcattc cgctgctcaa gaccaagctg ctggcgtttg cgctgagcgg ctttttcctc       720
     ggcattgctg gctcgctctg ggcttttacc tacctgggca cggtggagcc gcacgggttc       780
     gatttgaacc gctctttcca ggtgctgttc atcatcatcc ttagcgggct gggaagcatc       840
     ctgggcaact ttctgggtgc ggccttcatg gtgctgtttc cgctgctgct gtcgaacctg       900
     gccggtgcgc tgcccgtggg cctcatcgat ccgggccagt tggagaatct gcagaagttc       960
     atttttggcg cgctgatcat cgccttcctc atcaaggagc ccgaagggct ggcgcgcctg      1020
     tggcagcgtt ttcgagagcg cgtccgcctg tggccgttgc gctactga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page