(data stored in ACNUC7421 zone)

EMBL: CP000529.PE545

CP000529.PE545       Location/Qualifiers
FT   CDS_pept        581780..583105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0552"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="KEGG: ppu:PP_2770 hypothetical protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35872"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJP4"
FT                   /protein_id="ABM35872.1"
FT                   /translation="MFKPTFARSLVLALSLAAAAVTAQAEPEQYFPLQSYRVGPYAAGG
FT                   TGFFGGFIDYMQYVNANGGVNGVKLTWSECETEYVVEKGVECYERLKKGLNGAPAAATN
FT                   PLSVGIAYATLDRSTADKLPLITINHGRTDSTDGSVFPYAFPLQLNPYSEVSAIVNYIG
FT                   KQAGGLDKLKGQKIVTLYHGSPYGKETIPVLDLLAKKYGFTVEHVEVPHPGNEQQSQWL
FT                   NIRRAKPDWVILRGWGVMNPVALKTAQKVGFPANRIIGNIWSNSEDDAAPAGAAAKGFI
FT                   SITTHPSGTEFPVLKGIKKQVVDAGKGNLADPKRFGSVYYNLGVVNGILNIEALRIAQD
FT                   KFGKKPLSGEQVRWGFENLKLDDARLKSLGALGLVQPLKLSCADHEGGGAVRFQQWDGQ
FT                   KWSVISDWVQADRALLRPIIEESARKYAKEKGITPRDCGKEG"
     atgttcaaac ccactttcgc ccgcagtctc gtcctggcgc tcagcctggc cgccgccgct        60
     gtcactgccc aggccgagcc cgagcagtat ttcccgctgc aaagctaccg cgttggcccc       120
     tatgcggcgg gcggcaccgg atttttcggc ggcttcatcg actacatgca atacgtcaat       180
     gccaacggtg gcgtcaacgg cgtcaagctc acctggagcg aatgcgaaac cgagtacgtg       240
     gtcgaaaaag gcgtggaatg ctacgaacgc ctgaaaaaag gcctgaacgg cgctccggcg       300
     gcggccacca acccgctgtc cgtcggcatt gcctacgcca cgctggaccg ctcgaccgcc       360
     gacaagctgc cgctgatcac catcaaccac ggccgcaccg attcgaccga cggcagcgtg       420
     tttccgtatg ctttcccgct gcaactcaat ccgtattccg aggtgtcggc catcgtcaac       480
     tacatcggca agcaggccgg ggggctggac aagctcaagg gccagaagat cgtcacgctc       540
     taccacggtt cgccctacgg caaggaaacc attcccgttc tcgatctgct ggccaaaaaa       600
     tacggcttca cggtcgagca tgtcgaagtg ccgcaccccg gcaacgagca gcaatcgcag       660
     tggctcaaca tccgccgcgc caagccggac tgggtgattt tgcgcggctg gggcgtgatg       720
     aacccggtgg cgctcaaaac cgcgcagaag gtgggtttcc cggccaaccg catcatcggc       780
     aacatctgga gcaattccga ggacgacgcc gctcctgccg gtgccgccgc caagggcttc       840
     atctccatca ccacgcaccc gtcgggcacg gagtttccgg tgctcaaggg catcaagaaa       900
     caggtggtcg atgccggcaa gggcaacctg gccgatccca agcgcttcgg ctcggtctat       960
     tacaacctgg gcgtggtcaa cggcatcttg aacatcgagg cgctgcgcat cgcccaggac      1020
     aagttcggca agaaaccctt gagcggcgag caggtgcgct ggggttttga aaacctcaag      1080
     ctcgacgacg cccgcctcaa gagcctgggt gcgctgggac tggtgcagcc actcaagctg      1140
     tcctgcgccg accacgaagg cggcggcgcc gtgcgctttc agcagtggga cggccagaag      1200
     tggagcgtga tcagcgactg ggtgcaggcc gaccgggcct tgctgcgccc gatcattgag      1260
     gaatctgccc gcaagtacgc caaggaaaaa ggcatcacgc cgcgtgactg cggcaaggaa      1320
     ggctga                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page