(data stored in ACNUC7421 zone)

EMBL: CP000529.PE552

CP000529.PE552       Location/Qualifiers
FT   CDS_pept        589793..590053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35879"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJQ1"
FT                   /protein_id="ABM35879.1"
FT                   /translation="MAALAVWAGNWNSHRNSYAKVKMPSGPVRRTLPFIGRSPAQCFNR
FT                   RLCIRSRGCVALLPGLQFIRHVFLEVIGTMRTLHKHKKLFF"
     atggctgcgc tggctgtttg ggctggcaac tggaacagcc atcgcaacag ttatgccaag        60
     gtgaaaatgc cttccgggcc ggtgcgccgc actctcccat tcatcggccg cagtcctgcg       120
     caatgcttca atcgacgcct gtgcatccgg tctcggggtt gtgtggcgct gttgccgggc       180
     ttgcagttca tcaggcatgt atttttagag gtaatcggca ctatgcgcac gctgcataag       240
     cataagaagc tattttttta a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page