(data stored in ACNUC7421 zone)

EMBL: CP000529.PE553

CP000529.PE553       Location/Qualifiers
FT   CDS_pept        590500..591714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0560"
FT                   /product="Alkanesulfonate monooxygenase"
FT                   /EC_number="1.14.14.5"
FT                   /note="PFAM: luciferase family protein; KEGG: bxe:Bxe_B1542
FT                   alkanesulfonate monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35880"
FT                   /db_xref="GOA:A1VJQ2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019911"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJQ2"
FT                   /protein_id="ABM35880.1"
FT                   /translation="MSFEVFWFLPTSGDTRYLGKSNTGRPATNAYMRQIAVTAESLGYD
FT                   GLLIPTGSSCLDPWVTASSLIAVTQRIKLLVALRTSVTGPTASARQAATLDQALNGRLL
FT                   LNVVPGGDAAELAAEGVYLDHDQRYEAADEFITVWRDLMAGKTVDFTGKHVNVKQARNF
FT                   FPPVQQPAPPLYFGGSSPAAHELAAKHVDAYLTWGEPPAAVAEKIADVRRRAEKYGRTV
FT                   RFGVRLHVIVRETNEEAWAAAERLISRLDDDTIAKAQSNYASMDSEGQRRMAALHGGRR
FT                   DQLEVSPNLWAGVGLVRGGAGTALVGDAQTVAARLQEYADLGVDTFVLSGYPHLEESIR
FT                   FAELVFPLLPGKEPVTLIDQVLTGGAFDVRATAPAVAPQSAEKAAEKPASAAGQAIAAE
FT                   RAVAV"
     atgagttttg aagttttctg gtttcttccc acgtccggcg acacccgcta tctgggcaag        60
     tccaataccg ggcgtcccgc caccaatgcc tacatgcgcc agatcgccgt cacggccgaa       120
     agcctcggct atgacggcct cctgatcccc accggcagca gctgcctgga cccgtgggtc       180
     acggcctcca gcctgattgc ggtgacccag cgcatcaagc tgctggtggc gctgcgcacc       240
     tccgtcaccg gccccacggc cagcgcgcgc caggcggcga cgctggatca ggcgctcaat       300
     ggccggctgc tgctcaatgt cgtgcccggc ggcgatgcgg ccgaactggc cgccgaaggc       360
     gtttacctcg accacgacca gcgctacgag gcggccgatg aattcatcac cgtctggcgc       420
     gacctgatgg ccggcaagac cgttgatttc acaggcaagc acgtcaacgt caagcaggcc       480
     aggaacttct ttccgccggt gcagcagcct gcgccaccgc tgtactttgg cggctcctcg       540
     ccagcggcgc atgagctggc cgccaagcac gtcgatgcct acctgacctg gggcgagcct       600
     ccagcggccg tcgccgagaa aatcgccgat gtgcgccgcc gcgccgaaaa atacgggcgc       660
     acggtgcgct tcggcgtacg cctgcatgtc atcgtccgcg agaccaatga ggaagcctgg       720
     gccgccgccg agcgcctgat cagccggctc gacgacgaca ccatcgccaa ggcccagagc       780
     aactacgcca gcatggactc cgaaggccag cggcgcatgg ccgcgctgca cggcggacgg       840
     cgcgaccagc tcgaagtcag cccgaacctg tgggctggtg tcggcctggt gcgcggcggc       900
     gcgggcacgg cgctggtggg cgacgcgcag accgtggcgg cgcgcctgca ggaatacgcc       960
     gacctgggcg tggacacctt tgtgctgtcg ggctacccgc acctggagga atcgatccgc      1020
     ttcgccgaac tggtgttccc gctgctgccg ggtaaagagc cggtcacgct gatcgaccag      1080
     gtgctgaccg gcggggcgtt cgacgtgcgc gccaccgccc cggccgttgc gccgcaaagc      1140
     gctgaaaaag ccgccgaaaa gcccgcttcc gcagccggcc aggccatcgc tgctgaacgc      1200
     gcagtagccg tatga                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page