(data stored in ACNUC7421 zone)

EMBL: CP000529.PE555

CP000529.PE555       Location/Qualifiers
FT   CDS_pept        592589..593578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0562"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="TIGRFAM: cysteine synthases; cysteine synthase A;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit; KEGG: eba:ebA4678 cysteine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35882"
FT                   /db_xref="GOA:A1VJQ4"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJQ4"
FT                   /protein_id="ABM35882.1"
FT                   /translation="MSTIYADNSQSIGRTPLIQLRRITDGAHATVLAKIEGRNPAASVK
FT                   CRIGAALIWDAEQRGLLGAGKEIVEPTSGNTGIALAFVAAARGIPITLTMPETMSIERR
FT                   KLLLAYGAKLVLTEGAKGMKGAIAKAEEIAASDPKYVLLQQFKNPANPAIHEATTGPEI
FT                   WQDTDGGIDIFISGVGTGGTITGVSRYLKKTQGKAIISVAVEPSASPILTQHRAGEELK
FT                   AGPHKIQGIGAGFVPEVLDLSLVDAIEQVSNEEAIDHARRLAREEGILAGISGGAAVAA
FT                   AVRWAKKPESAGKTLVVIIPDSGERYLSSVLFEGIFDASGAAVNQELA"
     atgtccacca tttacgctga caactcgcag tccatcgggc gcacgccgct cattcagctg        60
     cggcgcatca ccgacggcgc ccatgccacg gtgctggcca agatcgaggg ccgcaatccg       120
     gccgcttcgg tcaagtgccg catcggtgcg gcgctgatct gggacgccga gcagcgcggc       180
     ctgcttggcg cgggcaagga aatcgtcgag cccaccagcg gcaacaccgg cattgcgctg       240
     gcctttgtcg cggcggcgcg cggcattccg atcacgctca cgatgccgga aaccatgagc       300
     atcgagcggc gcaagctgct gctggcctat ggcgcgaagc tggtcttgac cgaaggcgcc       360
     aagggcatga aaggcgccat tgccaaggcc gaggaaattg ccgccagcga cccgaaatat       420
     gtgctgctgc agcagttcaa gaatcccgcc aacccggcga ttcacgaagc caccaccggc       480
     cccgaaatct ggcaggacac cgacggcggc atcgacatct tcatctcggg cgtgggcacc       540
     ggcggcacga tcaccggcgt gtcgcgctac ctgaaaaaaa cccagggaaa agccatcatt       600
     tcggtggccg tcgagccgtc ggccagcccg atcctgaccc agcaccgggc cggtgaggaa       660
     ctcaaggcag ggccgcacaa gatacagggc ataggtgccg gattcgtgcc cgaggtgctg       720
     gacttgtcgc tggtcgatgc gatagagcag gtcagcaacg aggaggcgat tgaccatgcc       780
     cggcgcctgg cgcgggaaga gggcattctg gcggggattt ccggtggcgc agccgttgcg       840
     gcagcggtac gctgggcgaa aaagccggaa agcgcgggca agaccctggt ggtcatcatt       900
     cctgactcgg gggagcgcta tctgagttca gtcctgtttg aaggaatttt tgatgccagc       960
     ggtgctgcgg tcaatcagga attggcttga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page