(data stored in ACNUC7421 zone)

EMBL: CP000529.PE556

CP000529.PE556       Location/Qualifiers
FT   CDS_pept        593702..594727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0563"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="TIGRFAM: sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein; PFAM: extracellular solute-binding
FT                   protein, family 1; KEGG: pol:Bpro_2345 thiosulphate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35883"
FT                   /db_xref="GOA:A1VJQ5"
FT                   /db_xref="InterPro:IPR000957"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJQ5"
FT                   /protein_id="ABM35883.1"
FT                   /translation="MAERRTFRRPFLKIALATTLAAASWGAIAQQAVNLLNVSYDPTRE
FT                   LYVEYNAAFIKYWKAKTGQDVTIKQSHGGSGKQARSVIDGLDADVVTLGLAGDIDALVN
FT                   NGGWIPKDWQKRLPHNSSPYTSTIVLVVRQGNPKGIKDWDDLIKPGVSVITPNPKTSGG
FT                   ARWNYLAAWEFAKRKFGGDAKAKDFVAKLYANVPVLDTGARGSSITFAQRNQGDVFISW
FT                   ENEAYLLEKEFGSKVDVVYPSLSILAEPPVSVVDKNVDRKGTRAVAEEYLKYLYTEEGQ
FT                   DIAGKNFYRPAVSEKAKAKYAKQFPNLKLFTIEQGFGGWTKADKEHFADGGSFDQIYLK
FT                   K"
     atggctgaac gccgcacttt tcgccgtccc tttctgaaaa tcgccttggc aaccacgctg        60
     gcggcggcgt catggggcgc catcgcccag caggccgtca acctgctcaa cgtatcgtat       120
     gacccgaccc gcgaacttta tgtggaatac aacgccgcgt tcatcaaata ctggaaagca       180
     aaaactggcc aggacgtgac catcaagcaa tcccacggtg gctcgggcaa gcaggcgcgg       240
     tcggtgattg acggactgga tgcagacgtg gtgacgctgg ggcttgccgg tgacatcgac       300
     gcgctggtca acaacggcgg gtggattccc aaggactggc aaaagcgcct gccgcacaac       360
     tcgtctccct acacctccac catcgtgctg gtggtgcgcc agggcaaccc caaaggcatc       420
     aaggactggg atgacctgat caagcccggt gtcagtgtca tcacgcccaa ccccaagacc       480
     tccggcggcg cgcgctggaa ttacctcgcc gcctgggagt tcgccaaacg caaattcggc       540
     ggcgatgcca aggccaagga tttcgtggcc aagctctacg ccaacgtgcc cgtgctcgac       600
     actggcgcgc gcggctcgtc gatcacgttc gcgcagcgca accagggcga tgtcttcatt       660
     tcctgggaaa acgaagccta cctgctggag aaggaattcg gcagcaaggt cgatgtggtc       720
     tatccctccc tcagcatcct ggctgaaccc ccggtcagcg tggtggacaa gaacgtggac       780
     cgcaagggca cccgcgccgt ggccgaggaa tacctgaaat acctctacac cgaagaaggg       840
     caggacattg ccggcaagaa cttctaccgc cccgccgttt ccgaaaaggc caaggccaag       900
     tacgccaaac aattccccaa tctcaagctg ttcaccatcg agcagggctt tggcggctgg       960
     accaaagccg acaaggaaca ctttgccgac ggcggctcct ttgaccagat ttacctgaaa      1020
     aagtaa                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page