(data stored in ACNUC7421 zone)

EMBL: CP000529.PE557

CP000529.PE557       Location/Qualifiers
FT   CDS_pept        594770..595945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0564"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase;
FT                   KEGG: pfo:Pfl_3918 sigma-54 specific transcriptional
FT                   regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35884"
FT                   /db_xref="GOA:A1VJQ6"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJQ6"
FT                   /protein_id="ABM35884.1"
FT                   /translation="MNQLLTFPDAGKHALSIRAKALVFEDPQSQALLARLDQVAPTEAT
FT                   VVIIGETGTGKELLARRIHQGSARRGPFVAVNCGAFSESLIDAELFGHESGAFTGASQA
FT                   RAGWFEAANGGSLFLDEIGDLPLALQVKLLRVLQERQIVRIGSRKPIELDVRLIAATNV
FT                   DLRDAVNAGHFRADLYYRLSVATLELRPLWERPGDILPLARHFLASYAKRLGIEGSTLT
FT                   PGAEQALLAHDWPGNIRELENVVHYALIVAPAAAIHASDLQSIQRSARSRARQPVALPP
FT                   AVADSSASTPEVAAVPTLRQMLRELLLKSMKLNQPLLFEQVQATLVCTAFEFCHNNQVQ
FT                   TARLLGLSRNVLRTLLKQHGLLAAHEDSSPDTGDFAADLLVGQPVAASSMA"
     atgaaccagc tactgacctt tcccgatgca ggcaaacatg ccttgtccat tcgcgccaag        60
     gcactggtgt ttgaagaccc gcagtcccag gccttgctcg cgcgcctgga ccaggtggca       120
     cccaccgagg ccaccgtcgt gatcatcggt gaaaccggca ccggcaagga gctgctggcg       180
     cgccgcattc accagggcag cgcacggcgc ggccccttcg tggcggtcaa ctgcggtgcg       240
     ttcagcgaat cgctgatcga tgcggagctg tttggccacg agagcggggc cttcaccggc       300
     gccagccagg cccgggccgg ctggttcgag gcggccaatg gcggcagctt gtttctcgat       360
     gaaattggcg acttgccgct ggcgctgcag gtcaagctgc tgcgcgtgct gcaagagcgc       420
     cagatcgtgc gcatcggctc gcgcaagccc atcgagctgg atgtgcggct gattgccgcc       480
     accaacgtgg acctgcgcga cgcggtgaac gcaggccact ttcgtgccga cctttactac       540
     cggctcagcg tggcgacgct ggagctgcgt ccgctgtggg agcggccggg cgatattctt       600
     ccgctggccc ggcattttct ggccagctac gccaaacgcc tggggattga gggcagcacg       660
     ctgacgccgg gtgccgagca ggcgctgctg gcgcatgact ggccgggcaa tatccgggag       720
     ctggaaaatg tcgttcacta cgcgctgatt gtggcccccg cagccgccat ccacgcgagc       780
     gacctgcagt cgatccagcg ttcggcacgc agccgggcgc gtcagcctgt ggccttgccg       840
     ccagcggtgg cggacagcag cgccagcacg ccggaagtgg ctgccgtccc cacgctgcgg       900
     caaatgctgc gtgaactgct gctcaaatca atgaagctca accagccgtt gctctttgaa       960
     caggtgcagg caacgctggt ttgtaccgct ttcgagttct gccacaacaa tcaggtgcag      1020
     accgcacgtc tgctcggcct gtcgcgcaat gtgctgcgca ccttgctcaa acagcatggg      1080
     ctgctggcgg cgcatgaaga cagcagcccc gataccggcg actttgccgc agacctgctc      1140
     gtcgggcagc cggttgcggc ttcttccatg gcttga                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page