(data stored in ACNUC7421 zone)

EMBL: CP000529.PE560

CP000529.PE560       Location/Qualifiers
FT   CDS_pept        complement(599861..601135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0567"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   rso:RS02155 putative transport transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35887"
FT                   /db_xref="GOA:A1VJQ9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJQ9"
FT                   /protein_id="ABM35887.1"
FT                   /translation="MRSFPSLNHEPIHPEAGRPLRRARWIGLGVLALLLGGAGARAYVN
FT                   AAHAKSVEERTGRSAIRSVLTTQARAAQGLRTVALPATLRGRNEAALYARTNGYVRSWS
FT                   KDIGDKVKKGDLLALIDTPEVDQDLAQAQATQEQIKARLALAQSSLARWEGLRQRDAVS
FT                   QQELDERRAAQQQALADLAASQANVRRLRQMHDFGRITAPFDGVVIKRNVEVGALVAAG
FT                   SATTTRELFYLAQSDALRLTVAIPQVYAADVAVGKEVSIKLLERPNAPGKGQITRVSGG
FT                   VDVATRSVQVEVSMDNQRGDFLPGAYVEVALPLSGAAMTLLLSPSTLQFRQDGAQVAVV
FT                   GEDGKVSLRQVKLGRDLGRSVEVIAGISPKDAIILNPPDTIEEGERVLVRKAPEDKPVP
FT                   KPAGGASRPAEAKADGDKDAKGGKA"
     atgcgttctt tcccttccct gaatcatgag cccatccacc ccgaggcggg ccgcccgctg        60
     cgccgggcgc gctggattgg gctcggtgtg ctggcgttgc tgctgggtgg cgccggtgcg       120
     cgcgcctatg tcaacgcggc ccacgccaaa tccgtcgagg agcgcaccgg gcgcagcgcc       180
     atcaggtcgg tgctgaccac ccaggctagg gcggcccaag gcctgcgcac ggtggccctg       240
     ccggccacgc tgcgcgggcg caacgaagcg gcgctctacg cccgcaccaa cggctatgtc       300
     cgttcctgga gcaaggacat cggcgacaaa gtgaaaaagg gcgatctgct ggccctgatc       360
     gacacgcccg aggtggacca ggatctggcc caggcgcagg ccacgcagga gcagatcaag       420
     gcccggctgg ccctggccca gtcgtccctg gcgcgctggg aaggcctgcg ccagcgcgac       480
     gcggtgtcgc agcaggaact cgatgagcgg cgcgctgccc agcagcaggc gctggccgat       540
     ctggccgcct cgcaggccaa tgtgcggcgc ctgcggcaga tgcacgactt cggccgcatt       600
     accgcgccgt ttgacggggt ggtgatcaag cgcaatgtcg aggtaggcgc gctggtggcc       660
     gccggcagcg ccacgactac ccgcgagctg ttctacctgg cgcagtccga cgccctgcgc       720
     ctgacggtgg cgattccgca ggtctatgcg gccgatgtgg cggtgggcaa ggaagtcagc       780
     atcaagctgc tggagcgccc gaacgcgccg ggcaagggac agatcacccg ggtctcgggc       840
     ggggtggacg tggccacgcg ctcggttcag gtcgaggtca gcatggacaa ccagagggga       900
     gactttctgc ccggcgcgta tgttgaggtg gctctgccgc tgagcggcgc ggccatgacc       960
     ctgctgctct cgcccagcac cctgcagttt cgccaggacg gcgcgcaggt agccgtggtg      1020
     ggcgaggacg gcaaggtcag cctgcgccag gtcaagctgg gccgggatct ggggcgctcg      1080
     gtggaggtga ttgcgggcat ttcgcccaag gacgccatca tcctgaaccc gcccgacacg      1140
     attgaagagg gcgagcgcgt gctggtccgg aaagcgcccg aggacaagcc ggtgccgaaa      1200
     ccggcaggcg gcgcctcgcg ccctgccgag gccaaggctg acggtgacaa ggacgccaag      1260
     ggtggcaagg catga                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page