(data stored in ACNUC7421 zone)

EMBL: CP000529.PE563

CP000529.PE563       Location/Qualifiers
FT   CDS_pept        complement(605150..606154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0570"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: rba:RB1022 gluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35890"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJR2"
FT                   /protein_id="ABM35890.1"
FT                   /translation="MTTKNILGRALLAASVAGVFASAAAQAQSPAPSGAVTPAIAGVVA
FT                   AGTPIELIKEGFHGTEGPVALPDGSLIFTETTANRVTRIAPDGATSTFVEGSNGANGLG
FT                   FTANGDLYAVQVLKARVGIIFPTTKARTLADNFEGAPFGRPNDLVVDSRGNVYFTDSGA
FT                   NPPVAGQPAPPVQATAPAKPAVYRISAKGELKRLAADIERPNGIQLSPDEKVLYVANTL
FT                   GEHLLAYDIAPDGALGPRRNFAKLEGWQKTDTGNSSGADGLAVDEAGRVYVASNKGIEV
FT                   FSSQGEALGSIALPKKPQNLAFAGERKKTLYAVGRGAAYRLPVLTAGYAGRAK"
     atgacaacaa aaaacatcct tggccgcgcc ctgctggccg ccagtgtggc cggagttttt        60
     gcctcggcag ccgcccaggc gcaaagcccc gcgccctccg gggcggtgac gccggccatt       120
     gccggcgtgg tggcggcggg aacgccgatt gagctgatca aggaaggttt ccatggcacc       180
     gaggggccgg tggccttgcc agacggcagc ctgatcttca ccgaaaccac ggccaaccgc       240
     gtgacccgca tcgcgcccga tggggcgacc tcgaccttcg tcgagggcag caatggcgcc       300
     aatgggctgg gcttcaccgc caacggcgac ctgtacgcgg tgcaggtact gaaagcccgc       360
     gtgggcatca tcttcccgac gaccaaggcc aggacgctgg ccgacaactt tgagggggcg       420
     ccgtttggcc gtcccaatga cctggtggtg gacagccggg gcaatgtcta tttcaccgat       480
     tccggcgcga acccgcctgt ggcgggtcag ccggcgccgc ccgtgcaggc gaccgcgcca       540
     gccaagcctg cggtttaccg catctcggcc aagggggaac tcaagcgcct ggcggctgac       600
     atcgagcgcc ccaacggcat ccagctcagc ccggacgaaa aagtactgta tgtggccaac       660
     accctaggcg agcacttgct ggcctatgac atcgcgcccg acggcgccct cgggccgcgc       720
     cgcaacttcg ccaaattgga aggctggcaa aagaccgaca ccggcaactc cagcggcgcc       780
     gacggcctgg ccgtggacga ggcgggccgc gtctatgtgg ccagcaacaa gggcatcgag       840
     gtgttcagca gccagggcga ggcgctgggc agtatcgccc tgccgaaaaa gccgcagaac       900
     ctggcctttg ccggcgagcg caaaaagacc ctgtacgcgg tggggcgcgg tgcggcctac       960
     cgcctgccgg tgctgactgc cggttatgcc gggcgcgcca agtaa                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page