(data stored in ACNUC7421 zone)

EMBL: CP000529.PE567

CP000529.PE567       Location/Qualifiers
FT   CDS_pept        complement(607966..609417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0574"
FT                   /product="protein of unknown function DUF1501"
FT                   /note="PFAM: protein of unknown function DUF1501; KEGG:
FT                   sus:Acid_1146 protein of unknown function DUF1501"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35894"
FT                   /db_xref="GOA:A1VJR6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJR6"
FT                   /protein_id="ABM35894.1"
FT                   /translation="MNNDSRRDFLRKSGVYLGGAAAMSGVIPGLGSFSAAHAADLVDPL
FT                   ALKGPHFPGKIKSVIWLHQDGAPSTLDLYDYKPELIKLAGKEVPASFLKGIKTSTQGGV
FT                   GKLYASKREWKQHGQSGAWFSDLLPNLAKQADHMTFIKSSVTVGATHDISILKLNTGDL
FT                   NPGRPSLGAWITYALGSANKDLPPYVVLYNGDREPQAGSVNWSSGFLPAVYQGTAFRPG
FT                   DSPILYLDRPELRTAQQQRKSLDLLKRLNSAGAERYPSDSELRARIQSYELADRMQAAA
FT                   PAAVDISKESAATKEMYGLNDKTSQSYGEVLLRARRLVENGVRFVQVVSAVPQSLDSER
FT                   RNWDAHDELEQNHGLLSKMVDKPIAGLLADLKSRGLLDSTLVVWASEFGRTSWGESGSG
FT                   RDHNPWGYTQWMAGGGLKAGFTYGETDEIGLQTADKDKAMDTYDLHATILHLMGLDHLK
FT                   TTFLNNGRSERPTVVYGKVVKDLLA"
     atgaacaacg attcccgccg cgactttctt cgcaaatccg gggtgtacct cggtggcgcc        60
     gccgccatga gtggtgtgat cccgggcctg ggcagctttt ctgccgccca tgcggccgat       120
     ctggtcgatc cgctggcact caaggggccg catttcccgg gcaagatcaa gtcggtgatc       180
     tggctgcatc aggacggcgc accgagcacg ctggacctgt atgactacaa gcccgaactg       240
     atcaagctgg ccggcaagga ggttccggcc tccttcctca agggcatcaa gaccagcaca       300
     caaggcggtg tcggcaagct ctacgcgtcc aagcgcgaat ggaagcagca tggccagagc       360
     ggcgcctggt tctcggacct gctgccgaac ctggccaagc aggctgacca catgaccttc       420
     atcaagtcca gcgtgacggt gggcgcaacg cacgacatct cgatcctcaa gctcaacacc       480
     ggcgacctca acccggggcg cccgtccctg ggggcgtgga tcacttatgc actggggtcg       540
     gccaacaagg atctaccgcc ctatgtggtg ctgtacaacg gtgaccgcga gccccaggcc       600
     ggctcagtca actggagttc gggctttctg ccggcggtgt accagggaac ggccttccgt       660
     ccgggcgatt ccccgatcct gtacctggac cgtcccgaac tgcgcacggc ccagcagcag       720
     cgcaagtcac tcgacctgct caagcgcctg aactcggcgg gtgccgagcg ctacccgtcc       780
     gacagcgagt tgcgcgcccg catccagtcc tacgagctgg ccgaccgcat gcaggccgcc       840
     gcgcccgccg ccgtcgatat cagcaaggaa agcgccgcca ccaaggagat gtacggcctg       900
     aacgacaaga ccagccagag ctacggcgag gtgctgctgc gcgcgcgccg cctggttgaa       960
     aacggtgtgc gcttcgtgca ggtggtctcg gccgtcccac agagcctgga ttcggagcgc      1020
     cgcaactggg acgcccacga cgagctggag caaaaccacg ggctgctctc gaagatggtg      1080
     gacaagccaa tcgccggcct gctggccgac ctgaagtcgc gcggcctgct cgacagcacg      1140
     ctggtggtct gggcctcgga gttcgggcgc acctcctggg gcgagagcgg cagcgggcgc      1200
     gaccacaacc cctggggcta cacccagtgg atggccggtg gcggcctcaa agccggcttc      1260
     acctacggcg agaccgacga gatcggcctg cagacggccg acaaggacaa ggcaatggac      1320
     acctacgacc tgcacgccac catcctgcac ctgatgggcc tggaccacct caagaccacc      1380
     ttcctgaaca acggccgctc cgagcgcccg acggtggtgt acggcaaggt ggtcaaggac      1440
     ctgctggcct ga                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page