(data stored in ACNUC7421 zone)

EMBL: CP000529.PE571

CP000529.PE571       Location/Qualifiers
FT   CDS_pept        614962..615825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0578"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B2062 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35898"
FT                   /db_xref="GOA:A1VJS0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJS0"
FT                   /protein_id="ABM35898.1"
FT                   /translation="MSASTADINVFPVSFARAESARWHRHALGAAKAGLKAAHTLLLGL
FT                   ILPALLFALWWIATEHHWVAEQILPPPAFVWDSLKDVLASGELLGHVGFSAARVAWSLL
FT                   IGGSVGLLLGFGMGLSRTFKAYVFPTFDVLAQLPVLGWIPLLIIFVGIEEALKVTAVSI
FT                   AVVVPVALSTLSGIANIPQALLEVGRVYQFSALQTIRRIVLPAAAPSLFTGLRQGVMQA
FT                   WISVIFVELLSSSEGLGFFMAYSRSLSQIDMVIVAMLAIGVVGIVIELGLRLIESRLQG
FT                   WRRSAF"
     atgagcgcat ccaccgccga tatcaacgtc tttcctgttt cctttgcgcg agccgaatcg        60
     gcccgctggc atcggcatgc gctgggtgcc gccaaggccg gcctgaaggc agcgcacacg       120
     ctgctgctcg gcctgatcct gcccgccttg ctgtttgcgc tgtggtggat cgccaccgag       180
     caccactggg tggccgagca gatattgccg ccaccggctt tcgtctggga ctcgctcaaa       240
     gatgtgctgg catcgggcga gttgctgggc catgtcgggt tcagcgccgc gcgcgttgcc       300
     tggagcctgc tgatcggcgg ctcggtggga ttgctgctgg gctttggcat gggcctgtcg       360
     cgcactttca aggcttacgt ttttcccacc ttcgatgtgc tggcccagtt gccggttctg       420
     ggatggattc cgctgctgat catctttgtc ggcatcgagg aagccctgaa agtgaccgcc       480
     gtgtccatcg cggtggtcgt tccggtggca ttgagcacgc tcagcggcat tgccaacatt       540
     ccgcaggccc tgctcgaagt cgggcgggtt taccagttca gcgctttgca gaccatccgc       600
     cgcatcgtgc tgcccgccgc cgcgcccagc ctgttcaccg gcctgcgcca gggcgtgatg       660
     caggcctgga tttccgtcat ctttgtcgag ctgctctcgt ccagcgaagg gctgggcttt       720
     ttcatggcct acagccgctc gctcagccag atcgacatgg tgatcgtggc catgctggcc       780
     atcggcgtgg ttggcatcgt catcgagctg ggcctgcgcc tgattgagtc gcgcctgcaa       840
     ggctggcgcc gttcggcttt ttga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page