(data stored in ACNUC7421 zone)

EMBL: CP000529.PE577

CP000529.PE577       Location/Qualifiers
FT   CDS_pept        complement(619563..620090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0584"
FT                   /product="periplasmic protein thiol--disulfide
FT                   oxidoreductase DsbE"
FT                   /note="TIGRFAM: periplasmic protein thiol--disulphide
FT                   oxidoreductase DsbE; PFAM: Redoxin domain protein; KEGG:
FT                   dar:Daro_3997 periplasmic protein thiol:disulfide
FT                   oxidoreductase DsbE"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35904"
FT                   /db_xref="GOA:A1VJS6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJS6"
FT                   /protein_id="ABM35904.1"
FT                   /translation="MRRFLFPLGLFFSLVCLLGAGLRLNPQEIPSPLIGKPAPAFALAQ
FT                   LALPDKTFGPQDMQGQVWLLNVWASWCTACRQEHPLLLELAGRNQVSIVGMDYMDARAD
FT                   GAKWLEKHGNPYRLSILDTDGKVGIDYGVYGVPETFVIDKRGVIRLKLAGPVTAEIIEK
FT                   KLLPLIKELNRA"
     atgcgacgtt ttctgtttcc cctgggtctg tttttttccc tggtctgcct cctcggggcc        60
     gggctgcgcc tgaatccgca ggaaattccc tcgcccctga ttggcaagcc cgccccggct       120
     ttcgcgctgg cgcagctggc gctgcccgat aaaacctttg gcccgcaaga catgcagggc       180
     caggtctggc tgctcaacgt ctgggcctcg tggtgtaccg cgtgccggca ggagcatccg       240
     ctgctgctgg aactggccgg gcgaaaccag gtgagcatcg tcgggatgga ctacatggat       300
     gcgcgcgctg acggggccaa gtggctggaa aagcatggca acccctaccg gctctccatc       360
     ctggacaccg atggcaaagt cggcattgac tacggggttt acggcgtgcc ggaaaccttt       420
     gtgatcgaca agcgcggcgt gattcgcctc aagctcgccg ggccggtcac cgccgagatc       480
     atcgagaaaa aactgctgcc gctgatcaag gagctgaacc gtgcgtag                    528
//

If you have problems or comments...

PBIL Back to PBIL home page