(data stored in ACNUC7421 zone)

EMBL: CP000529.PE578

CP000529.PE578       Location/Qualifiers
FT   CDS_pept        complement(620099..622096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0585"
FT                   /product="cytochrome c-type biogenesis protein CcmF"
FT                   /note="TIGRFAM: cytochrome c-type biogenesis protein CcmF;
FT                   PFAM: cytochrome c assembly protein; KEGG: neu:NE0768
FT                   cytochrome c-type biogenesis protein (CcmF)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35905"
FT                   /db_xref="GOA:A1VJS7"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJS7"
FT                   /protein_id="ABM35905.1"
FT                   /translation="MIAELGNFSLVLALCLACVQGSLPLLGAYRGEPRWMALGRSAAFG
FT                   QCLFVTLGFAALVYVFAVNDFSVSYVAANSNSRLPLHFRVAAVWGGHEGSVLLWIQMLA
FT                   LWTAAVAVFSRSLPAGTVARVLGVMGLISIGFLCFLLFTSNPFDRTLPAAADGRDLNPM
FT                   LQDLGMIAHPPILYMGYVGFSVAFAFAIAALLEGRLDAAWARWSRPWTLLAWAFLTLGI
FT                   ALGSAWAYYVLGWGGWWFWDAVENASFMPWLVGTALIHSLAVTEKRDTFKNWTVLLAIL
FT                   AFSLSLLGTFLVRSGVLSSVHAFASDPRRGIYILVFLAVVVGGALALYAWRAPGVGLGG
FT                   RFALFSRESLLLVNNVLLVVTAGTVLLGTLYPLLLDALGLGKISVGAPYFEAVFVPLML
FT                   PFLLLIAVGPLASWKQASFKGVLRRLRWIAVGAVLFALGVALALNTSVMVAVGLALAAW
FT                   VLLGTAAELAGRLRHAALGAPLRQRLASLPRSYWGMLLAHAGIGVFVIGVTMVRGLDAS
FT                   SDHSMRVGDSATLGDYRFTFARLERVEGKNYIAARARFEVTRGAGPVAILYPEKRFYTV
FT                   QQMPLTDAAIDRGWLRDLYVSLGEATQDGAWVVRLQHKPFMNWVWGGTLFMALGGALAA
FT                   SDRRYGWGRKRSAKRPLADAAVTPSVQPAT"
     atgatcgccg aactgggcaa cttctcgctg gtgctggcgc tgtgcctggc ttgtgtgcag        60
     ggcagcctgc cgctgctggg cgcgtaccgg ggcgagccgc gctggatggc gctggggcgc       120
     agcgcggctt ttggccagtg cctgttcgtc acgctgggtt tcgcggcgct ggtgtatgtc       180
     ttcgccgtca acgatttttc ggtgagctac gtggccgcca actcgaactc gcgcctgccg       240
     ttgcatttcc gggtggccgc cgtctggggc gggcatgaag gctcggtgct gctgtggatt       300
     cagatgctgg ccctgtggac cgccgccgtg gccgtgttca gccgctccct gccggcggga       360
     accgtggcgc gcgtgctggg cgtgatgggg ctgatcagca tcggtttcct gtgttttcta       420
     ttgttcacct ccaacccttt tgaccgcacc ctgccggccg cagcggacgg gcgtgacctg       480
     aacccgatgc tgcaggacct gggcatgatc gcgcacccgc ccatcctcta catgggctac       540
     gtgggcttct cggtggcttt tgcgtttgcc attgcggcct tgctggaggg tcgcctggac       600
     gcggcctggg cgcgctggtc gcgcccgtgg acgctgctgg cctgggcttt cctcacgctg       660
     ggcatcgcgc tgggcagcgc ctgggcctac tatgtgctgg gctggggcgg ctggtggttc       720
     tgggacgcgg tggaaaacgc gtccttcatg ccctggctgg tgggcaccgc gctgatccat       780
     tccctggcgg taaccgaaaa acgcgacacc ttcaagaact ggaccgtgct gctggcgatt       840
     ctggcgtttt ccttgtcgct gctcggcacc ttcctggtcc gctcgggcgt gctgagttcg       900
     gtgcatgcct ttgccagcga cccgcgccgg ggtatttaca tcctggtctt cctggccgtc       960
     gtggtggggg gcgcgctggc gctctacgcc tggcgcgcgc ccggcgtcgg cctgggaggg      1020
     cgttttgccc tgttctcgcg cgagtcgctg ctgctggtca acaacgtgtt gctggtcgtg      1080
     acggctggca cggtgttgct tggcacgctg tacccgctgc tgctcgacgc cctgggcctg      1140
     ggcaagattt cggtcggcgc gccgtatttc gaggccgtct tcgtgcccct gatgctgccc      1200
     ttcctgctgc tgatcgcggt ggggccgctg gcttcgtgga agcaggcctc cttcaaaggg      1260
     gtgttgcgcc ggctgcgctg gatcgccgtg ggggcggtgc tgtttgccct gggggtggcg      1320
     ctggcgctca acacctcggt gatggtggca gtgggattgg cgctggcggc ctgggttctg      1380
     ctcggcaccg ctgctgagct ggccgggcgc ctgcgccatg ccgcgctggg cgcgccgctg      1440
     cgccagcgtc tggccagcct gccgcgcagc tattggggca tgctgctggc ccacgcgggc      1500
     atcggcgtgt tcgtgatcgg cgtcaccatg gtcaggggac tggacgcatc gagcgaccac      1560
     agcatgcgcg tgggcgacag cgccaccctg ggcgactacc gcttcacctt tgcccggctg      1620
     gagcgtgtgg aagggaaaaa ctacatcgcg gcgcgtgcgc gtttcgaggt cacgcggggc      1680
     gccggcccgg tagccatcct gtaccccgaa aaacgcttct acaccgtgca gcagatgccg      1740
     ctgaccgacg cggccattga ccggggatgg ctgcgcgacc tctacgtgtc actgggcgag      1800
     gctacccaag acggcgcctg ggtggttcgc ctgcagcaca agccgttcat gaactgggta      1860
     tggggcggga cgctgttcat ggcgctgggc ggggcgctgg cggcctcgga ccggcgctac      1920
     ggctggggcc gcaaacgcag cgccaaacgc ccgctggccg atgccgccgt cacgccttcc      1980
     gttcaacctg ccacctag                                                    1998
//

If you have problems or comments...

PBIL Back to PBIL home page