(data stored in ACNUC7421 zone)

EMBL: CP000529.PE581

CP000529.PE581       Location/Qualifiers
FT   CDS_pept        complement(623530..624198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0588"
FT                   /product="heme exporter protein CcmB"
FT                   /note="TIGRFAM: heme exporter protein CcmB; PFAM:
FT                   cytochrome c-type biogenesis protein CcmB; KEGG:
FT                   nmu:Nmul_A1216 heme exporter protein CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35908"
FT                   /db_xref="GOA:A1VJT0"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJT0"
FT                   /protein_id="ABM35908.1"
FT                   /translation="MLKVLACVIQRDLLLAFRRRADLLATVFFFVIVVTLFPLGVGPEP
FT                   ALLRSMAPGIVWVAALLASLLSLGRLFALDFADGTLEQMALSAEPLVLIVLGKVLAHWL
FT                   VAGVPLVMLSPVLALQFGLPGAAIQVLCLGLLIGTPILSLLGAIGSALTLGVRGGGVLL
FT                   ALLVLPLYVPVLIFGAGAVQAQASGLDAAAHLLLLGGVLAGALALAPWATSAALRIALE
FT                   "
     atgctgaagg tgctggcatg cgtgattcag cgcgatctgc tgctggcctt caggcgccgc        60
     gccgacctgc tggccaccgt gtttttcttt gtcatcgtgg tcacgctgtt tccgctgggc       120
     gtggggccgg agccggccct gctgcgcagc atggcgcccg gcatcgtatg ggtggcggcc       180
     ttgctggctt cgctgctgtc gctggggcgg ctgttcgcgc tcgactttgc cgacggaacg       240
     ctggagcaga tggccttgtc ggccgagccg ctggtgctca tcgtgctggg caaggtgctg       300
     gcgcactggc tggtggcggg cgttcccctg gtgatgctct cgcccgtgct ggcgctgcag       360
     tttggtttgc ctggcgctgc gatccaggtg ctgtgcctgg gcttgctgat aggcacgccc       420
     atcctgagtt tgctgggggc gattggcagc gccctgactc tgggcgtgcg cggtggcggg       480
     gttttgctgg cgctgctggt gctgccgctg tatgtgccgg tgctgatttt tggcgcgggc       540
     gcggtgcagg cccaggccag cggcctggac gccgccgccc atctgctgct gctgggcggc       600
     gtgctggcag gcgcgctggc gctggcgccc tgggccacct cggcagcgct gcgaatcgcc       660
     ctggaataa                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page