(data stored in ACNUC7421 zone)

EMBL: CP000529.PE584

CP000529.PE584       Location/Qualifiers
FT   CDS_pept        complement(625646..626110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0591"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ttj:TTHA0836 rhodanese-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35911"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJT3"
FT                   /protein_id="ABM35911.1"
FT                   /translation="MAATLLSLSVCAAFAQQASPAASASGNTAAADVWKYKTKRLDRAG
FT                   VDALLAKPQKLVVIDVRRPDELTAKGSFPVYLNIQVNDVEKSLAYIPKDRAILTVSNRA
FT                   HRAGAVGDLLTSKGFKVAGAAGSQDYEDQGGTITRVTAPPPKPTTASAAP"
     ttggctgcca ccctgttaag tctgagcgtt tgcgccgcgt ttgcgcagca ggccagcccg        60
     gccgccagtg cctccggcaa cactgctgcc gccgatgtgt ggaagtacaa aaccaagcgg       120
     ctcgatcgcg caggcgtgga cgccctgctg gccaagcccc agaagctggt ggtgattgac       180
     gtgcgccgcc ccgatgaact caccgccaag ggaagttttc cggtctatct gaacattcag       240
     gtcaatgacg tggagaaaag cctggcctac atccccaagg atcgcgccat cctgaccgtc       300
     tccaaccgtg cccaccgtgc cggtgcggtg ggtgatctgt tgactagcaa gggcttcaag       360
     gtggctggcg ccgccggttc ccaggattac gaggaccagg gcggaacgat tacccgcgtg       420
     actgcgccgc cacccaagcc caccacggca tcagccgccc cctga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page