(data stored in ACNUC7421 zone)

EMBL: CP000529.PE590

CP000529.PE590       Location/Qualifiers
FT   CDS_pept        630162..631676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0598"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   sco:SCO5857 FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35917"
FT                   /db_xref="GOA:A1VJT9"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJT9"
FT                   /protein_id="ABM35917.1"
FT                   /translation="MDMYNENENQWTNWAGSITTLPDTFCQPKSVRELQDIVIQNEGSI
FT                   IRCFGSGHSWTPLVVTNGGILIDPTGITENGQKAFRWQKNGLNLVTCFPSARWADVREA
FT                   LTTDGPLPKMYLPTAGVLPSINATGFVAAGCHGTGWEQPTVSDLIQAIEFVAADGKVHV
FT                   FSEDTTPNEMNTVRVSVGMLGVITKVTLKVDPMYRLWDQERLVPTAEVMGANPESRGGA
FT                   IDSSKLHALVTGNEYVELFWFPGSGFDGSIWVKQYNRTQDDPRDIPLRTDDDWVDSMAG
FT                   PVMQWSAQQPMVIPAVQALTWKTINDRVKVIESNKGFVADAPRVLHYQLKAFPILDLEV
FT                   AMPIPATGPNAWDFSNVVKAWWQAVNYTRVKWAAGKYPLTTCLHARFTKNSQALLSPAF
FT                   EPAHSETHYCWIEILSAYPKNDPNPNNRSAAMSEFDEMANRVVGEYWIKELKGRPHWSK
FT                   YWHKISPPVNIKSLLPQANLDTFNSLRRSLDPQDIFLNPFLRKQML"
     atggacatgt acaacgaaaa cgagaaccaa tggacgaatt gggccggtag catcacgacg        60
     cttcctgata cgttctgtca gccaaaaagc gtccgcgaac tgcaggacat cgtgatccag       120
     aacgagggca gcatcatccg ctgcttcgga agcggacact cctggacccc cctcgtcgtt       180
     accaacggag gcattcttat tgacccaacg ggaatcacag agaacggcca gaaggcattc       240
     cgctggcaga agaatgggct caatctcgtg acctgcttcc cgtcggcccg atgggcagac       300
     gttcgcgaag cgcttaccac tgacggtccc ttgcccaaga tgtatctgcc taccgcaggc       360
     gttcttccca gcatcaacgc gacggggttc gtcgcggctg gatgccacgg caccggctgg       420
     gagcagccga cggtgtcaga tctgatccaa gccatcgaat tcgttgccgc agatggaaag       480
     gtccacgtat tctcggagga cacgaccccc aatgagatga acacggttcg ggtcagcgtc       540
     ggcatgctcg gagtcatcac gaaggtcact ctcaaagtcg atcccatgta caggctctgg       600
     gaccaggagc ggctcgtccc gaccgccgag gtgatgggcg cgaaccccga atccaggggc       660
     ggcgcgattg actcatcaaa gttgcatgcc ctcgtcaccg gcaacgaata cgttgagttg       720
     ttctggtttc ccggcagtgg gttcgatggg tcgatctggg tgaagcagta caaccgtacc       780
     caggacgatc cccgcgacat cccgctgcgc acggatgacg actgggtcga ttcgatggct       840
     ggacccgtga tgcaatggag tgcacaacaa ccgatggtta ttcccgccgt gcaggcgctc       900
     acctggaaaa cgatcaatga ccgcgtgaag gtcatcgagt ccaacaaagg cttcgtcgcc       960
     gatgccccca gggttctgca ctatcaactg aaagccttcc ccatcctcga cttggaggtc      1020
     gcgatgccga tccccgccac cgggccgaac gcctgggatt tctcgaacgt cgtgaaagcc      1080
     tggtggcagg cggttaacta cacccgtgtc aaatgggcgg cgggcaagta ccccctgacg      1140
     acatgcctgc acgcccgatt caccaagaac agccaggcgc tcctttctcc tgcgttcgaa      1200
     cctgctcaca gtgaaaccca ctactgctgg atcgagatcc tcagcgccta tccgaagaac      1260
     gatcccaacc cgaacaaccg gtcggcagcc atgtccgaat tcgacgagat ggcgaaccgg      1320
     gtcgtcggcg agtactggat caaggaacta aaaggccgac cgcactggtc caagtactgg      1380
     cacaagattt cccccccggt caatatcaag tcgctcttgc ctcaggcgaa cctcgatacg      1440
     ttcaacagcc tcaggcgaag tctcgacccc caggatatct tcctcaatcc ctttctgagg      1500
     aagcagatgc tctaa                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page