(data stored in ACNUC7421 zone)

EMBL: CP000529.PE591

CP000529.PE591       Location/Qualifiers
FT   CDS_pept        complement(631708..632685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0599"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   bbr:BB0660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35918"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJU0"
FT                   /protein_id="ABM35918.1"
FT                   /translation="MRNLLNAPAIIAAALAFTFATAHAADAYPSKPIRMVVAFAAGGSA
FT                   DINARIVGQQLGKELGGTIVVDNKGGAGGNLGAVEVKRAAPDGYTFFYATSAVVLAPSL
FT                   YSKPGFDPYSDFTPVSLTATIPLVLVVNPNVPAKTVAELVAYGKANPNRLNYGSSGAGA
FT                   LLHLGGALFTKETGIQATHVAYKGSAPAVVDLLGGVTQFMFLPINEVMTHIKGGTLRAL
FT                   AVTNDKRSALLPDVPTLREATGKTTMDMGAWQGLMLPKGTPADVLGKVKAALENSLKDK
FT                   AMRDRLTAQGSIVLGGTQKEYADYMKQEGDRWARVIRDTGAKAD"
     atgcgcaatc tactcaacgc accggcaatc atcgccgccg cactggcttt cacattcgcg        60
     acggcgcatg ccgccgatgc ctatccctcc aaaccgatcc gcatggtggt cgcctttgcg       120
     gcaggcggct cggccgacat caatgcccgc atcgtcgggc agcaactcgg caaggaactc       180
     ggtggaacca tcgtcgtgga caacaagggg ggtgcgggcg gcaacctcgg tgccgttgaa       240
     gtcaagcgtg ccgcgccgga tggctacacc ttcttctatg cgacttcagc cgtggtcctg       300
     gcgccgtcgc tgtattcgaa gccgggattc gatccctaca gcgacttcac tcccgtctca       360
     ctgaccgcca cgattccgct ggtgctcgtc gtgaacccga acgtgccggc caagacggtt       420
     gcggagttgg tggcctatgg caaggcgaat ccgaacaggc tcaactacgg gtcgtccggc       480
     gccggcgctc tgctgcacct gggcggcgcg ttgttcacca aggaaaccgg cattcaggcg       540
     acgcacgtcg cctacaaggg gagcgcgccg gccgtcgtgg atctgctggg cggagtgacc       600
     cagttcatgt tccttccgat caacgaggtc atgacgcaca tcaagggcgg cacgctgcgc       660
     gccctggccg tgacgaacga caagcggtcc gcgctcttgc ccgacgttcc gacccttcgg       720
     gaagccacgg gcaagaccac catggacatg ggcgcgtggc agggcctgat gcttcccaag       780
     gggacgcccg ccgacgtgct cggcaaggtg aaggctgcgc ttgagaactc gctcaaggac       840
     aaggccatgc gcgacaggtt gacggcgcaa ggctcaatcg tcctgggcgg tacgcagaag       900
     gagtatgccg actacatgaa gcaggagggt gatcgatggg cccgcgtgat tcgcgacacc       960
     ggggccaagg cggactga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page