(data stored in ACNUC7421 zone)

EMBL: CP000529.PE593

CP000529.PE593       Location/Qualifiers
FT   CDS_pept        complement(633394..634260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0601"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding
FT                   protein"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase, NAD-binding;
FT                   KEGG: nar:Saro_2815 6-phosphogluconate dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35920"
FT                   /db_xref="GOA:A1VJU2"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015814"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJU2"
FT                   /protein_id="ABM35920.1"
FT                   /translation="MHIAIIGLGEVGRCYAAPLQAAGFELSLCEARPSPAATALASSLG
FT                   LPIHDKPGPWLAGAQWVLSCVTGAVALEVVKGLAPLLARGAAIADLTTASPQAKRDAAL
FT                   AASGHDVGYVDTAIMGAISLNLVRTPLLASGKGAEEFKELIERAGGRVQVIAGGAAGDA
FT                   ISLKILRSVFTKGMEALCVELLMSAEKQGVREQLYEQLSDIDQTPLRSFIDMLVRTHVI
FT                   HAGRRAHEVHDAQSELASQGLASVVLPGVEQRFRITASALEKHPLALAEPSIDQALQWL
FT                   ASTADQA"
     atgcacatcg caatcattgg tttgggagaa gtcggccgtt gctacgcagc gccacttcag        60
     gcggctggtt ttgaactgag cttgtgcgag gcacgcccgt cgccggcggc gaccgccctt       120
     gcgtcttcct tgggcttgcc cattcacgac aagcccggcc catggctcgc gggcgcccag       180
     tgggtgctgt cgtgcgtgac gggcgcggtc gcgctcgaag tggtcaaggg gctggcgcct       240
     ttgctcgcca ggggcgcagc cattgccgac ctgaccacgg caagtccgca agccaaacgc       300
     gatgccgcgc ttgccgcctc cgggcacgac gtcggatacg tggacacggc catcatgggg       360
     gcgatctcgc tgaacctggt acgcacgccg cttctggcgt cgggcaaggg cgcagaagaa       420
     ttcaaggagc tcattgagcg cgccggcggc cgcgtgcagg tcatcgccgg tggcgctgcg       480
     ggcgatgcca tctcgctcaa gatcctgcgt agcgtgttca ccaagggcat ggaggcactc       540
     tgcgtcgaac tgctcatgag cgccgaaaag cagggggtgc gcgaacagct ctatgagcaa       600
     ctgagcgaca tcgaccaaac cccgctgcgc tctttcatcg acatgctggt tcgcacccat       660
     gtcatccacg ccgggcggcg ggcccatgaa gtccacgacg cgcaaagcga actcgcctcg       720
     caaggactgg cgtcggtcgt cttgccgggc gtcgaacagc gctttcgcat caccgccagc       780
     gcgctcgaaa agcacccgct ggcgcttgca gaacccagca tcgaccaagc cctgcaatgg       840
     ctggcctcca ccgccgacca agcctga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page