(data stored in ACNUC7421 zone)

EMBL: CP000529.PE596

CP000529.PE596       Location/Qualifiers
FT   CDS_pept        complement(635771..636760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0604"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   pol:Bpro_3116 twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35923"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJU5"
FT                   /protein_id="ABM35923.1"
FT                   /translation="MNHRRHFIQTLGSAAALAALSPLVARAQGLEQVKILYGFPPGSAG
FT                   DSVARRVGEKLAGSAYTKNAAVVENKPGAGGRIALETLKSAPADGSVLALAPVSGLSVY
FT                   PHIYSRLSYAPTDFAQVSIGAIMHHGLAVGPMVPAQVKTLKDFLAWAKANPAQASYGSP
FT                   GAGSMPHLLGALLGLRSGVDLKHVPYRGTVPGITDLVGGQIASTMNPSGDYLSYAKAGK
FT                   LRVLATSGPQRSPYSPNVPTFAEQGFGDLTVEEWFGFYAPAKTPAAVIASASAAINQAL
FT                   KEKVVLDSLAMVGLIAHGSTPEEMARSQKAEFERWGPLVKQTGFTAES"
     atgaaccatc gccgccactt catccagacg ctcggcagcg ccgccgcgct ggccgccctg        60
     tcgcccctgg tcgcccgcgc ccagggcctg gagcaggtca agattcttta tggctttccg       120
     cccggcagcg ctggcgacag cgtggcccgc cgcgtgggtg aaaaactggc cggctcggcc       180
     tacaccaaaa atgccgcggt cgtcgagaac aagcccggcg cgggcgggcg cattgccctg       240
     gagacgctga agtccgcccc ggccgacggc tcggtgctgg cgctggcgcc ggtgtcgggg       300
     ctgtcggtgt acccgcacat ctacagccgg ctgagctacg cgcccacgga tttcgcccag       360
     gtgtcgatcg gcgcgatcat gcaccacggc ctggccgtcg gcccgatggt gccggcgcag       420
     gtcaagacgc tgaaggactt cctggcctgg gccaaggcca atccggccca ggccagctac       480
     ggctcgccgg gcgcgggctc catgccgcac ctgctgggcg cgctgctcgg cctgcgttcg       540
     ggtgtggacc tcaagcatgt gccttaccgg ggcacggtgc ccggcatcac cgacctggtc       600
     ggcggccaga tcgcctcgac catgaacccg agcggcgact acctcagcta cgccaaggcc       660
     ggcaagctgc gcgtgctggc cacgtccggg ccgcagcgct cgccgtattc gccgaatgtg       720
     cccaccttcg cggagcaggg cttcggcgac ctgacggtcg aggaatggtt cggcttttac       780
     gccccggcca agacgccggc agcggtgatc gccagcgcct cggcggccat caaccaggcg       840
     ctgaaagaaa aagtggtgct cgacagcctg gcgatggtcg gcctgatcgc ccatggctcc       900
     acgcccgaag aaatggccag gtcgcaaaag gccgagttcg aacgctgggg accgctggtc       960
     aagcagaccg gcttcaccgc agagtcctga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page