(data stored in ACNUC7421 zone)

EMBL: CP000529.PE599

CP000529.PE599       Location/Qualifiers
FT   CDS_pept        complement(638908..639954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0607"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bja:bll6212 transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35926"
FT                   /db_xref="GOA:A1VJU8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJU8"
FT                   /protein_id="ABM35926.1"
FT                   /translation="MMSRSMASLDGCISASSALMWEDAVHTGIGRMPAELRHQEVIHLL
FT                   PVGAQAFSGRIDYGDLAGTGLCRMTASPHRFQRALREGASLAASPLILVIQVKNSSYFE
FT                   QRERSGMLSPGDWCVLDTYRPFGWNSASGCEQIIMTIQRPADSGLGDLIARGAAQRCDG
FT                   KTGAARILQAMVSEVMGQIHHLAPYSAGSLASALTATAWNALQEQLEAPAPILLRDTQC
FT                   SRLKAWIETRLAEPDLSVDTIAQGCRMSARSVHRAFSSDPTGSVSSYLWQRRVVQCAAA
FT                   LKNPQEMHRSITDIALSWGFSSSSHFSRVFRSTLGVSPRSYRAGGQHADWLAAWSGVVP
FT                   EPDRPKAS"
     atgatgtcac gttccatggc ttcccttgat ggctgtatct ccgccagctc ggcgctgatg        60
     tgggaggacg cagtgcatac cggcatcggc cgcatgccgg ccgagctgcg ccatcaggag       120
     gtcatacacc tcctgccggt gggcgcacaa gccttcagcg gccgcatcga ctatggtgac       180
     ctggctggca ccggcctgtg ccgcatgacg gccagcccgc accgttttca gcgcgccctg       240
     cgtgaaggcg catcccttgc cgccagcccg ctgatcctcg tcatccaggt caagaactcc       300
     agttacttcg agcagcgcga acgcagcggc atgctcagcc ccggcgactg gtgcgtgctg       360
     gacacgtacc ggccgttcgg ctggaacagc gcatcgggct gcgagcagat catcatgacc       420
     atccagcggc cggccgattc ggggctgggc gacctgatcg cacgtggcgc ggcgcagcgc       480
     tgcgatggca agaccggcgc ggcgcgcatt ctgcaggcca tggtgagcga agtgatgggc       540
     cagatccacc acttggcgcc ctacagcgcc ggatcactgg ccagcgccct gacggcgact       600
     gcgtggaatg cgctgcaaga gcaacttgag gcacctgctc cgatcctgct gcgcgacacc       660
     caatgcagcc ggctcaaggc ctggattgaa acgcggctgg ccgagcctga tctgtcggtt       720
     gacacgatag cccagggctg ccgcatgtcg gcgcgcagtg ttcaccgcgc cttttccagt       780
     gaccctaccg gctcggtttc gagctatctc tggcagcgcc gcgtggttca gtgcgccgcc       840
     gcgctgaaaa acccgcagga aatgcaccgc tccatcaccg acatcgccct gtcctgggga       900
     ttttcaagct cgtcgcattt cagccgggtg ttcaggagca ccctgggcgt gtcgccacgc       960
     agctacaggg ccgggggcca acacgctgac tggctggcgg cctggtcggg ggtagttcca      1020
     gaacccgacc gcccaaaggc aagctga                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page