(data stored in ACNUC7421 zone)

EMBL: CP000529.PE602

CP000529.PE602       Location/Qualifiers
FT   CDS_pept        642669..644111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0610"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: bte:BTH_I0706
FT                   aldehyde dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35929"
FT                   /db_xref="GOA:A1VJV1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJV1"
FT                   /protein_id="ABM35929.1"
FT                   /translation="MTTLHLHINSENIAAQDGRTFERRNPVTGQLVSTAAAASPQDALQ
FT                   AVEAASRAFAAWSATGPGERRALLNKAADELQAAAPAFIKAMMEETGASALWAGFNVMT
FT                   AAGILREAAAITTQIAGEVIPSDVPGNVSMALRQAAGVVLGIAPWNAPVILGVRAIAVP
FT                   LACGNTVILKGSELCPATHRMIVDAFERAGFPAGVVNFITHAPEDAGAVVEAMVAHKAV
FT                   RRVNFTGSTKVGKIIALLCAQHLKPALLELGGKAPFVVLDDADLDQAADAAAFGAFLHS
FT                   GQICMSTERIIVDEAVADEFVERLAARARQLQPGTGDSPIASVIDMATVHRCNALIDDA
FT                   LAKGATLLCGGKASNTLMAPTLLDHVTPAMKIYREESFGPVKGIVRVSGTDEAVRCAND
FT                   NDYGLSSAVFSRDTARALGIAQRIESGICHINGPTVHDEPQMHFGGVKNSGIGHFGGQS
FT                   GIAAFTDLRWVTLQTSPRHYPF"
     atgaccaccc ttcatttgca tatcaacagc gaaaacatcg cagcccagga cggccgcact        60
     ttcgagcgcc gcaacccggt caccggccag ctggtgtcca cggccgccgc cgcttcgccg       120
     caggatgccc tgcaagccgt cgaggcggcc agccgcgcct ttgccgcctg gtcggccacc       180
     ggccccggcg aacgccgggc actgctgaac aaggcagccg acgagttgca ggccgcagcg       240
     cctgcgttca tcaaagccat gatggaagaa accggcgcca gcgccttgtg ggccggcttc       300
     aacgtcatga ctgccgccgg cattttgcgg gaggccgcag ccatcaccac gcaaatcgcc       360
     ggtgaagtga ttccgtccga tgtacccggc aatgtctcca tggccctgcg ccaggcggcc       420
     ggcgtggtgc tgggcatcgc cccctggaat gcacccgtca tcctgggcgt gcgcgccatc       480
     gccgttccgc tggcctgcgg caacacggtc atcctgaagg gctccgaact ctgcccggcc       540
     acgcacagga tgatcgttga tgcgttcgag cgggccggtt ttccggctgg cgtggtgaat       600
     ttcatcaccc atgcacccga agacgctggc gccgtggtgg aggccatggt cgcgcacaag       660
     gcggtgcggc gtgtcaactt caccggctcg accaaagtcg gcaagatcat cgcgctgctg       720
     tgcgcccagc acctcaagcc ggccctgctg gaactcggcg gaaaggcgcc gtttgtggtg       780
     ctggacgatg ccgacctcga ccaggccgcc gatgctgcgg cgtttggcgc ctttttgcat       840
     tcaggccaga tctgtatgtc caccgaacgc atcatcgtgg acgaggccgt ggccgacgag       900
     tttgtggaac ggctggcggc aagggcgcgc cagctccagc ccggcaccgg tgattcaccg       960
     attgcctcgg tcattgacat ggcaaccgtg caccgctgca acgcactgat tgacgatgcg      1020
     ctggccaaag gcgccacgct gctgtgcggc ggcaaggcct cgaataccct gatggccccg      1080
     accctgctgg accatgtgac accggccatg aaaatctacc gcgaagaatc ctttggcccg      1140
     gtcaagggca tcgtgcgggt cagcggcacg gatgaagccg ttcgctgcgc caatgacaac      1200
     gactacggcc tgtcgtccgc cgtcttcagc cgcgacacgg cccgcgccct gggtattgcc      1260
     cagcgcatcg aatcgggcat ttgccacatc aacgggccca cagtgcatga cgagccgcag      1320
     atgcactttg gcggcgtcaa aaacagcggc atcggccact tcggcggcca gtcgggcatc      1380
     gccgccttca ccgacctgcg ctgggtcacg ctgcagacct cgccgcgcca ctatccgttc      1440
     tga                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page