(data stored in ACNUC7421 zone)

EMBL: CP000529.PE64

CP000529.PE64        Location/Qualifiers
FT   CDS_pept        68499..69125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0065"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   pol:Bpro_0075 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35391"
FT                   /db_xref="GOA:A1VIB3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIB3"
FT                   /protein_id="ABM35391.1"
FT                   /translation="MPGSFVGVADYGAFVVAILVFLAIPGPGNLALITSTGKGGIAGGM
FT                   GATLGVIAGDQVLLWAAVAGVSAVMAAYPAAFHVVQWLGAIYLAWLGLRMLLAKPGSAP
FT                   ILQIKPRHYFRQALLITLLNPKAIVFYLAFFPLFVDPAQHQGLKTFGVMAATIAVLTFL
FT                   YGLMAVLLTWKLAARLRANPKISATLEKAAGMFLIAFGIKLALSR"
     atgccgggct cgttcgttgg tgttgccgac tatggcgctt ttgttgtcgc tattctggtc        60
     tttctggcca ttcccggccc cggcaacctg gcgctgatca cctcgaccgg caagggcggc       120
     atcgccggcg gcatgggcgc caccttgggc gtcatcgctg gcgaccaggt gctgctgtgg       180
     gctgccgtgg cgggcgtttc ggccgtcatg gcggcgtatc cggctgcctt tcatgtggtc       240
     cagtggctgg gcgctattta cctggcctgg ctgggtttgc gcatgctgct ggccaagccc       300
     ggcagcgcac ccattttgca gatcaagccg cgccactact ttcggcaggc attgctgatc       360
     accttgctca accccaaggc catcgtgttt tacctggctt tttttccgct gttcgtggac       420
     ccggcgcagc accagggcct taaaacattt ggcgtgatgg ccgcgaccat cgccgtgctg       480
     acttttttgt atggcctgat ggcggtgctg ctgacctgga agctggccgc gcgcctgcgg       540
     gccaatccga aaatatcggc cacgcttgaa aaagccgccg gcatgttcct gatcgccttt       600
     ggcatcaagc tggcgctttc ccgatag                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page