(data stored in ACNUC7421 zone)

EMBL: CP000529.PE67

CP000529.PE67        Location/Qualifiers
FT   CDS_pept        70682..71617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0068"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /note="TIGRFAM: parB-like partition proteins; PFAM: ParB
FT                   domain protein nuclease; KEGG: pol:Bpro_0078 ParB-like
FT                   partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35394"
FT                   /db_xref="GOA:A1VIB6"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIB6"
FT                   /protein_id="ABM35394.1"
FT                   /translation="MVTKKQKGLGRGLEALLGPKVDESPEAANALIAASSPGLPASLLL
FT                   DDLVPGQYQPRTRMDEGALYELAESIKVQGIMQPILVRRLKSGSNSGKYEIIAGERRFR
FT                   AARLAGLDSLPVLIRDVPDESAAAMSLIENIQREDLNPLEEAQGLQRLVKEFGLTHELA
FT                   AQAVGRSRSAASNLLRLLNLADPVQTMLMAGDLDMGHARALLALDRATQITAANQITAK
FT                   KLSVREAESLVKKLGSEFSLTPNKAPPEKSRDTRRVEEELADLLMAEVQVRIKKQVKRN
FT                   GKREDVGELAIQFASLDEVNGLIERLRRTA"
     atggtcacca aaaaacaaaa aggcctgggt cgcgggctcg aagcgctgct cggcccgaag        60
     gtcgatgaat cgcccgaagc cgccaatgcc ctgatcgccg ccagcagccc cggcctgccg       120
     gcttcgctgc tgctcgacga cctggtgccc ggccagtacc agccgcgcac ccgcatggac       180
     gagggcgcgc tctacgaact ggccgaatcg atcaaggtgc agggcatcat gcagcctatc       240
     ctggtgcggc gcctcaagag cggaagcaac agcggcaagt acgaaatcat cgccggcgaa       300
     cggcgtttcc gggccgcccg gctggccggg ctggacagcc tgccggtgct gatccgcgac       360
     gttcccgacg agtcggccgc cgccatgtcg ctgattgaaa acatccagcg cgaagacctc       420
     aatccgctcg aagaagcgca gggcctgcag cgcctggtca aggaattcgg cctgacccac       480
     gagctggccg cgcaggccgt gggccgctcg cgcagcgccg cgtccaattt gttgcgcctg       540
     ctgaacctgg ccgacccggt gcagaccatg ctgatggctg gcgacctgga catgggccat       600
     gcgcgcgcgc tgctggcgct ggaccgggcg acgcagatca ccgccgccaa ccagatcacg       660
     gctaaaaagt tgtcggtgcg cgaggccgaa agcctggtca agaagctggg cagcgagttc       720
     tcgctgaccc ccaacaaggc cccgcctgaa aaatcgcgcg acacccgccg cgttgaagaa       780
     gaactggccg acctgctgat ggccgaggtg caagtgcgca tcaaaaagca ggtcaagcgc       840
     aacggcaagc gtgaagatgt cggtgaactg gcgatccagt ttgcctcgct cgatgaagtc       900
     aacgggctga tcgagcggct gcgccggacg gcctga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page