(data stored in ACNUC7421 zone)

EMBL: CP000529.PE7

CP000529.PE7         Location/Qualifiers
FT   CDS_pept        complement(6920..7735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0008"
FT                   /product="septum site-determining protein MinD"
FT                   /note="TIGRFAM: septum site-determining protein MinD; PFAM:
FT                   Cobyrinic acid a,c-diamide synthase; KEGG: pol:Bpro_0019
FT                   septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35334"
FT                   /db_xref="GOA:A1VI56"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI56"
FT                   /protein_id="ABM35334.1"
FT                   /translation="MAKIIVVTSGKGGVGKTTTSASFATGLALRGHKTAVIDFDVGLRN
FT                   LDLIMGCERRVVYDLINVIQGEATLNQALIKDKQCPELFVLAASQTRDKDALTIDGVKK
FT                   VLDDLAAMDFEYIVCDSPAGIETGALMAMHFADEALVVTNPEVSSVRDSDRILGMLSSK
FT                   TQRAIDGGEPIKEHLLITRYNPSRVDQGQMLSLEDIQDILRIKLIGVIPESETVLQASN
FT                   QGVAAVHMQGTDVSEAYKDVIDRFMGEDKPMRFIDAQKPGFFKRLFGGK"
     atggcaaaaa tcattgtggt cacctccggc aagggcggcg tcggcaaaac caccaccagc        60
     gccagctttg caaccggcct ggccctgcgt ggccacaaaa ccgccgtgat cgactttgac       120
     gtcggcctgc gcaacctgga cctgatcatg ggctgcgagc gccgcgtggt gtacgacctg       180
     atcaacgtca tccagggcga agccacgctc aaccaggccc tcatcaagga caagcagtgc       240
     cccgaactgt tcgtgctggc cgcctcgcaa acccgcgaca aggacgcact gaccatcgac       300
     ggcgtcaaga aagtgctcga tgacctggcg gcgatggact ttgagtacat cgtctgcgac       360
     tcgcccgccg gcatcgagac cggcgcgctg atggcgatgc atttcgccga cgaagcgctg       420
     gtcgtcacca accccgaagt gtcctcggtg cgcgactccg accgcatcct gggcatgctg       480
     tcgagcaaga cccagcgcgc catcgacggc ggcgagccga tcaaggagca cctgctcatc       540
     acccgctaca accccagccg cgtcgatcag ggccagatgc tgtcgctcga agacatccag       600
     gacatcctgc gcatcaagct gatcggcgtc attcccgaat ccgaaaccgt gctgcaggcg       660
     tccaatcagg gcgtggcggc ggtgcacatg caaggcaccg acgtgtccga agcctacaag       720
     gacgtgatcg accgcttcat gggcgaggac aagccgatgc gcttcatcga cgcgcaaaag       780
     cccggtttct tcaaacgcct gttcggggga aagtaa                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page