(data stored in ACNUC7421 zone)

EMBL: CP000529.PE73

CP000529.PE73        Location/Qualifiers
FT   CDS_pept        77560..78861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35400"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIC2"
FT                   /protein_id="ABM35400.1"
FT                   /translation="MTRTRQWLLGAGVAAGMLALLAALLLSLVPSDEELAARASAELEA
FT                   ALGVPVRVGALHWRLRPTPTVVIEEVATGQPQPIEIKRLTAHLNTSALWQRRMKVDLAV
FT                   VQGAVLPQLSLRGLGRKPAAAEAGPAREFTLDEVPMARIEFGDVTWISRHGIRVVYEGE
FT                   ADFDAAWRPRTARLRRPQTSPPADLALARKGQDDRWEVRSHIGGGTADGELLLHTSGQG
FT                   GLRLTGQLQPRHIEVASALQAFNRRAIIAGKASGETTLSASGATAGELARSLHTTTSFS
FT                   MGRSTLLRFDLDKAIRSLGQAHAGQTPLDSVTGQIDTQNTPQGMVVTFSRLQARSGAFS
FT                   ASGKARVAELRIQAELAVDLVDGVVGVPLTLSGPLDKVQVSVPASALAGAAAGTAVLPG
FT                   IGTAIGARIGAAIGKLFGSEPEPAAGPRPAPGKQ"
     atgacgcgca cccgccaatg gctgctgggc gcgggcgttg ccgcaggcat gctggccctg        60
     ctggcggcgc tgctgctcag cctggttcct tcggatgagg aactggccgc tcgcgcctcc       120
     gccgagctgg aggcggcgct gggcgttccg gtccgcgtcg gcgcgctgca ctggcgcctg       180
     aggcccacgc ccacggtggt catcgaggag gtcgccaccg gccagcccca gccgattgaa       240
     atcaaaaggc tcaccgccca tctcaacacc tccgcgctct ggcaacgccg catgaaggtg       300
     gacctggccg tcgtgcaggg cgccgtgctg ccgcagctgt cactgcgcgg actgggccgc       360
     aagcccgcag cggcagaggc cgggccggcg cgcgaattca cgctggacga ggtgccgatg       420
     gcgcgcatcg agtttggcga tgtcacctgg atttcgcgcc acggcattcg cgtggtgtac       480
     gaaggggagg cggatttcga tgccgcctgg cggccgcgca cggcccggct tcgccgtccg       540
     caaaccagtc cgcccgccga cctggcgctg gcccgcaagg ggcaagacga ccgctgggaa       600
     gtgcgcagcc acatcggcgg cggaacggct gatggcgagc tgctgctgca caccagcggc       660
     cagggcggcc tgcgcctcac gggccagctc cagccgcgcc atatcgaggt ggccagcgcc       720
     ttgcaggcct tcaaccgccg cgccatcatc gcgggcaagg cgtcgggcga aaccacgctg       780
     tcggccagcg gcgccacggc gggcgaattg gcccggtcgc tgcataccac cacgtcgttc       840
     agcatgggcc gctcgacgct gctgcgcttt gacctggaca aggccattcg cagcctcggc       900
     caggcgcatg cggggcaaac cccgctggat tccgtcaccg gccagatcga cacccagaac       960
     acgccgcaag gcatggtggt gaccttcagc cggctgcaag cccgctcggg cgcattcagc      1020
     gcatcgggca aggcgcgcgt tgccgagctg cgcattcagg ccgaactggc ggttgacctg      1080
     gtcgatggtg tggtcggcgt gcccttgacg ctcagcggtc cgctggacaa ggtccaggtg      1140
     tcggtgccgg ccagcgccct ggccggcgcc gccgccggaa ccgccgtgct gccgggcatc      1200
     ggcacggcga taggcgcgcg gatcggggcg gccatcggca agctgttcgg ttcggagccc      1260
     gagcccgccg ccgggccgcg tcccgcgccc ggcaagcagt ga                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page