(data stored in ACNUC7421 zone)

EMBL: CP000529.PE74

CP000529.PE74        Location/Qualifiers
FT   CDS_pept        78921..79361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35401"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIC3"
FT                   /protein_id="ABM35401.1"
FT                   /translation="MFLQGSAKLDAFSLLFNTPTMSQHPTALFTPTSLERALDQNEAIQ
FT                   ETVEQSAAELCVINAVLQQEVPEHVKTGDVAQALQKTDELESRIQTSAENLEQVNQALK
FT                   EEIQVRADLERQLAATQAELDQVQNSAQNHAQAGAQGRSSSC"
     atgtttttac agggctctgc taagcttgat gcttttagtc tgctattcaa taccccgacc        60
     atgtcccaac acccgaccgc cttgttcacg cccacctcgc tggagcgtgc gctggaccag       120
     aatgaagcca tccaggagac ggtcgagcag tcggccgccg agttgtgcgt gatcaacgcg       180
     gtgctccagc aggaagtgcc ggagcatgtc aagaccggcg atgtggcgca ggcgctgcag       240
     aaaaccgatg agctcgaaag ccggattcaa acctccgccg agaacctgga gcaggtcaac       300
     caggcgctga aagaggaaat ccaggtgcgc gccgacctgg agcgccagct ggccgcgacc       360
     caggccgaac tggaccaggt gcagaactcc gcgcagaacc atgcgcaggc cggcgcgcag       420
     ggccggtcgt cctcctgcta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page