(data stored in ACNUC7421 zone)

EMBL: CP000529.PE76

CP000529.PE76        Location/Qualifiers
FT   CDS_pept        complement(80771..81925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0077"
FT                   /product="twitching motility protein"
FT                   /note="TIGRFAM: twitching motility protein; PFAM: type II
FT                   secretion system protein E; KEGG: lpp:lpp2271 twitching
FT                   motility protein PilU"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35403"
FT                   /db_xref="GOA:A1VIC5"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIC5"
FT                   /protein_id="ABM35403.1"
FT                   /translation="MPLPAQAAPSPSPSPSDPDDLGRYLALMVAHGASDLFLSAEVAAS
FT                   LKIQGRIRRLPEPPLTGTHIKRLAYSVMRDSQVREFEADLECDLAIAMDALGRFRVNVF
FT                   RQRGEVAVVVRHINSTIPTLESLKLPPVLKTLAMLKRGLVLVVGAAGSGKSTTLAAMLD
FT                   YRNNMASDHILTVEDPMEFEHSHKKCIVDQREVGLDTRSFDEALRRAMREAPDVIMIGE
FT                   IRDRETMQHAMAYAETGHLCVSTLHANNANQAIQRVLNFFPETAQRQVLMDLSLNLKGV
FT                   VGQRLLAGAAGKRVPAVEVMLLSPYVADLIQKGQTDEIKAVMAKSVELGMATFDQSLYE
FT                   LYVRGDITHEQAIEHADSKTDLSLRIRLASGRRPDTEALQVLRD"
     atgccactgc ccgcccaagc cgccccatcc ccgtccccat ccccgtccga tcccgatgac        60
     ctcgggcgct acctggcgct gatggtcgcc cacggcgcat ccgacctttt cctgtcggct       120
     gaggtggccg cctcgctcaa gatccagggc cgcatccgcc gcctgcccga gccgccgctg       180
     acgggaaccc acatcaagcg cctggcgtat tcggtgatgc gcgacagcca ggttcgcgag       240
     ttcgaggccg atctggagtg cgacctggcg attgccatgg atgcgctggg ccgctttcgc       300
     gtcaatgtgt tccgccagcg cggcgaggtg gcggtggtgg tgcggcacat caacagcacg       360
     atcccgacgc tcgaatcgct gaagctgccg ccggtgctga aaacgctggc catgctcaag       420
     cgcggcctgg tgctggtggt cggcgcggcc ggctcgggca aatcgaccac gctggcggcc       480
     atgctggact accgcaacaa catggccagc gaccacatcc tgacggtgga agacccgatg       540
     gagttcgagc acagccataa gaaatgcatc gttgatcagc gcgaggtcgg gctggacacg       600
     cgctctttcg acgaagcgct gcgccgcgcc atgcgcgaag cgcccgacgt gatcatgatc       660
     ggtgaaatcc gcgaccgcga aaccatgcag cacgccatgg cctatgccga aaccggccac       720
     ctgtgcgtct cgaccctgca tgccaacaat gccaaccagg ccatccagcg cgtgctgaat       780
     tttttcccgg aaaccgcgca gcgccaggtg ctgatggacc tgtcgctcaa cctcaagggc       840
     gtcgtcggcc agcgcctgct ggcaggcgcg gccggcaaac gggttccggc ggtcgaggtg       900
     atgctgctgt cgccctatgt cgccgatttg atccagaagg gccagaccga cgagatcaag       960
     gcggtgatgg ccaagagcgt cgagctgggc atggccacct tcgaccagtc gctgtacgag      1020
     ctgtacgtgc gcggcgacat cacgcacgag caggccatcg agcatgccga ctcgaaaacc      1080
     gacctgtcgc tgcgcatccg gctggcgtcc gggcgccgcc ccgacaccga agccctgcag      1140
     gtgctgcgcg actga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page