(data stored in ACNUC7421 zone)

EMBL: CP000529.PE79

CP000529.PE79        Location/Qualifiers
FT   CDS_pept        83455..84699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0080"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   ade:Adeh_3412 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35406"
FT                   /db_xref="GOA:A1VIC8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIC8"
FT                   /protein_id="ABM35406.1"
FT                   /translation="MKPLFKWGVGALLVLAVAGAAVLASRRGTPVQLVPVARTGIVQSV
FT                   VATGRLNAPARMDIGAEVTATVLEVRVREGDRVRAGALLLRLSDAEARAALQQASAALV
FT                   EARGRATQQATVAAPVAGQAVVQAEAAFTSAERDFQRARELVAQGFFSQQKLDDARRAL
FT                   DTARSALQSARVQAQANQPSGVERTLAASRVDQALAAVDIAQARLARLSIASPVDAIVL
FT                   TRSVEPGSMAQPGHVLLTLAAQGGTRIDANVDEKNLRLLTPGMPAKAVADAYPGQSFDA
FT                   QLNYIAPAVDPQRGTVEVRLAVPNPPPFLRPDMTVSVELVGGLKKDALVLPSGAVRDAD
FT                   REAPWVLALQDGLAVRVPVKLGLRGVGSIEITEGLKEGDAIIPQTEKAIAGDRVRPGPV
FT                   VAPVKGMETPSFISR"
     atgaaacctc ttttcaaatg gggcgttggc gccttgctgg tgttggccgt ggcgggcgct        60
     gccgtgctgg ccagccggcg cggcacgccg gtgcaactgg tgccggtggc ccgcaccggc       120
     atcgtgcagt cggtcgtcgc gaccgggcgg ctcaacgccc cggcacgcat ggacattggc       180
     gccgaagtca ccgccacggt gctcgaagtg cgcgtgcgcg aaggcgaccg cgtcagggcc       240
     ggcgcgctgc tgctgcgcct gtcggatgcc gaagcgcgcg ccgccttgca gcaggccagc       300
     gccgcgctgg tcgaagcgcg cggccgcgcc acccagcagg cgacggtggc cgcgccggtc       360
     gctggtcaag ccgtggtgca ggccgaagcc gcgttcacgt cggccgagcg cgacttccag       420
     cgcgcccgcg aactggtggc gcagggcttc ttttcgcagc aaaagctcga cgacgcccgg       480
     cgcgcgctcg acacggcccg aagcgcgctg cagtcggccc gggtgcaggc ccaggccaac       540
     cagcccagcg gcgtcgagcg cacgctggcc gcctcgcgcg tcgatcaggc cctggctgcc       600
     gttgacattg cgcaggcgcg gctggcgcgc cttagcatcg ccagcccggt cgatgccatc       660
     gtgctgacgc gcagcgtcga gcccggctcc atggcccagc ccggccatgt gctgctgacg       720
     ctggccgcgc agggcggcac ccgcatcgac gccaatgtcg atgaaaaaaa cctgcgcctg       780
     ctgacccccg gcatgcccgc caaggcggtc gccgacgcct accccggcca gtccttcgat       840
     gcgcaactga actacatcgc cccggcggtc gatccgcagc gcggcacggt cgaggtgcgg       900
     ctggcggtgc ccaatcctcc gccctttttg cggcccgaca tgacggtgtc ggtcgagctg       960
     gtcggtggcc tgaaaaagga cgcgctggtg ctgccctcgg gcgcggtgcg cgacgccgac      1020
     cgcgaagcgc cgtgggtgct ggcgctgcag gatggactgg cggtgcgcgt gccggtcaaa      1080
     ttgggcctgc gcggcgtcgg ttccattgaa atcaccgaag ggctgaaaga gggcgacgcc      1140
     atcattccac agaccgaaaa agccatcgcc ggcgaccgcg tgcggcccgg cccggtggtg      1200
     gcgccagtca agggcatgga aacgccgtcc ttcatttcac gctga                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page