(data stored in ACNUC7421 zone)

EMBL: CP000529.PE8

CP000529.PE8         Location/Qualifiers
FT   CDS_pept        complement(7871..8641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0009"
FT                   /product="septum site-determining protein MinC"
FT                   /note="TIGRFAM: septum site-determining protein MinC; PFAM:
FT                   Septum formation inhibitor MinC; KEGG: pol:Bpro_0020 septum
FT                   site-determining protein MinC"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35335"
FT                   /db_xref="GOA:A1VI57"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI57"
FT                   /protein_id="ABM35335.1"
FT                   /translation="MTMTAATLTTFEIKSANFPLVALLLKSTDLAALAREMTLRFGDIP
FT                   DFFDQDALVIDLSPLQNAGQAAAAEIDFRALISLLRSYRLVPIAVKGGNPAQMTAAQKA
FT                   GLVPGQDAHLLTPRPAAASAEQPAPQTQQQQPQLHAPPLGALVIDKPLRSGQQVYARGR
FT                   DLVVLAMVNAGAEVIADGHIHVYAPLRGRAIAGARGNTEARIFALTLEAELLSIAGIYR
FT                   TSENPLPPEVTGHPAQVRLVDGPDGERLVMTPMQ"
     atgaccatga ctgctgccac cttgaccacc tttgaaatca aaagcgccaa tttcccgttg        60
     gtcgcgctgc tgctcaagtc caccgacctg gcggcgctgg cgcgcgagat gacgctgcgc       120
     ttcggcgaca ttcctgattt tttcgaccag gacgcgctgg tcatcgacct gtcgccgctg       180
     caaaatgccg gccaggccgc tgcggccgag attgatttcc gcgccctgat cagcctgctg       240
     cgcagctacc ggctggtgcc gattgccgtc aagggcggca accccgcgca aatgaccgcc       300
     gcccagaaag ccggactggt tcccgggcag gatgcccacc tgctgacacc ccgcccggcc       360
     gccgcatcgg ccgagcagcc cgccccgcag acccagcagc agcaaccgca gttgcatgcg       420
     ccgccgctgg gcgcgctggt catcgacaag cccttgcgct cgggccagca ggtgtatgcg       480
     cgtggccgcg acctggtcgt gctggccatg gtcaatgccg gcgccgaagt cattgccgac       540
     ggccacatcc atgtgtatgc gcccttgcgc ggccgggcca ttgccggcgc gcgcggcaac       600
     accgaggcgc gcattttcgc gctgacgctg gaggccgaac tgctgtcgat tgccggcatc       660
     taccgcacca gcgaaaaccc gctgccgccc gaagtgaccg gccacccggc gcaagtgcgg       720
     ctggtggacg gcccggacgg cgaacggctg gtcatgaccc cgatgcagtg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page