(data stored in ACNUC7421 zone)

EMBL: CP000529.PE83

CP000529.PE83        Location/Qualifiers
FT   CDS_pept        87914..88234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0085"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: cch:Cag_1308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35410"
FT                   /db_xref="UniProtKB/TrEMBL:A1VID2"
FT                   /protein_id="ABM35410.1"
FT                   /translation="MALTRNFKETVIQRVQSDTSFAQALLDEAATLFLNGEPETARLIL
FT                   RDLVNATIGFEQLATLTAKPSKSLHRMLSSTGNPSMDNLAAIFQAVRQRLQVSLQAHSV
FT                   AV"
     atggcactga ctagaaattt caaggaaacc gtcattcaga gagtgcaaag cgatacgtcg        60
     tttgcgcagg cactgctgga tgaggcggcc actttgttcc ttaacggtga gcccgagacc       120
     gcccgcctca tcttgcgtga tctcgtcaac gccaccatcg gctttgagca actcgcaacg       180
     ctcaccgcca aaccgagcaa gagtctgcac cggatgttgt cctccacggg caatcccagc       240
     atggacaacc tggccgcgat ttttcaggca gtgcgccaaa ggctgcaggt cagccttcaa       300
     gcgcactcgg tagcagtctg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page