(data stored in ACNUC7421 zone)

EMBL: CP000529.PE84

CP000529.PE84        Location/Qualifiers
FT   CDS_pept        88241..88936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0086"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rpb:RPB_3881 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35411"
FT                   /db_xref="GOA:A1VID3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015854"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VID3"
FT                   /protein_id="ABM35411.1"
FT                   /translation="MTTPPAPILRLTDIHRSYNVGTEVETEVLHGISLSLQPAEFVALK
FT                   GPSGSGKSTLLNIIGLLERPTSGTLEIAGQPTGSLDDAGLTQLRGATIGFVFQFHHLLP
FT                   AFTALENVLLPSIIAHGTATLDAEANARELLARVGLKGAEYKRPGELSGGMQQRVAIAR
FT                   ALSLRPRLILADEPTGNLDTVSADEVFGLLREFNRDHGSACLIVTHDPRLAARCDRIIE
FT                   LVDGRLVAG"
     gtgaccactc cccccgcccc catcctgcgc ctgaccgaca tccaccgcag ctacaacgtc        60
     ggcacggaag tcgagaccga ggtgctgcac ggcatcagcc tgagcctgca gcccgccgag       120
     ttcgtcgcgc tcaaggggcc gtcgggttcg ggcaagagca cgctgctcaa catcatcgga       180
     ctgctggagc ggcccacgtc cggcacgctg gaaatcgccg gccagcccac cgggtcgctc       240
     gacgatgcgg gcctgacgca gttgcgcggc gcgaccatcg gcttcgtgtt ccagttccac       300
     cacttgctgc cggccttcac cgcgctggaa aacgtgctgc tgccatccat catcgcccac       360
     ggcaccgcca cgcttgacgc cgaagccaac gcacgggaac tgttggcccg tgtgggcctg       420
     aagggcgccg aatacaagcg ccccggcgaa ctctcgggcg gcatgcagca gcgcgtggcg       480
     atagcgcgcg cgctgtcgct gcgcccgcgc ctgatcctgg ccgacgagcc gaccggcaac       540
     ctcgacacgg tgtcggccga cgaggtgttc ggcctgctgc gtgagttcaa ccgcgaccac       600
     ggcagcgcct gcctgatcgt cacccacgac ccgcgcctgg ccgcgcgctg cgaccgcatc       660
     atcgagctgg tggatgggcg gctggtggcg ggttga                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page