(data stored in ACNUC7421 zone)

EMBL: CP000529.PE87

CP000529.PE87        Location/Qualifiers
FT   CDS_pept        complement(90501..92018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0089"
FT                   /product="adenylate cyclase"
FT                   /note="PFAM: CHAD domain containing protein; adenylate
FT                   cyclase; KEGG: rfr:Rfer_2024 adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35414"
FT                   /db_xref="GOA:A1VID6"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:A1VID6"
FT                   /protein_id="ABM35414.1"
FT                   /translation="MKKHPLAPSPEEIELKLALPTSSPSGLAGLAKRLAQTPVLARRKA
FT                   TRQQLHNIYYDTPGQRLHQKRVALRLRRVGSDANPSWLQTLKMGGRSDSALSQRGEWEL
FT                   PVPGAELARQALEATPWSKFDPDGSVFKALAPCIVTTFERTSWSVRKRGGSVVEVSLDI
FT                   GQVVAGDRRTPICELELELLAGQPAALFDIARQIARSVAVLPLNASKAERGYALLQDAQ
FT                   SLPLRARPPALTRNMALPLAAQCVLREMFGQFTSNLNTLTRSDDPEVVHQARVGWRRFR
FT                   SAWRLFQPALAAHAAAPAWQSLEPLLMFVGELRDLDVALNDTLPPLAAAYTAGNAQREE
FT                   KWQAMLQALTQAALLQRKSVRHALQTPAVGATLLAITQWLEELPASKGPDDAKAGPDIS
FT                   LRRWARQRITRQHKKMKQALKDTAHPESQHRARILSKRLRYGIEALRPLLPRRQAERWH
FT                   AKATALQTGIGATRDIMQAGVLAVRFEADPGLAEFLRGVAAGQPVPR"
     atgaaaaaac acccccttgc cccctcgccg gaagaaatcg agctcaagct ggctttgccc        60
     acgtccagcc cgtccgggct ggcaggcctg gccaagcggc tcgcgcagac gcccgtgctg       120
     gcgcgccgca aagcgacgcg gcagcaactg cacaacatct actacgacac ccccgggcag       180
     cgcctgcacc agaagcgtgt cgcgttgcgg ctgcggcgcg tgggcagcga cgcgaacccg       240
     tcatggctgc agaccctcaa gatgggcggc cgcagcgact cggccctgag ccagcgcggc       300
     gaatgggaac tgcccgtgcc cggcgccgaa ctggcacggc aggcgcttga agccacgccg       360
     tggtccaaat ttgacccgga cggcagcgtg ttcaaggcgc tggcgccgtg catcgtgacc       420
     accttcgagc gcaccagctg gtccgtgcgc aagcgcggcg gcagcgttgt cgaggtgtcg       480
     ctggacatcg ggcaggtcgt ggccggcgac aggcgcaccc ccatttgcga gctggaactc       540
     gaactgctcg cggggcagcc ggccgcgctg ttcgacatcg cccggcaaat cgcccgcagc       600
     gtcgcggtgc tgccgctcaa cgccagcaag gccgagcgcg gctacgcctt gctgcaggac       660
     gcccagagcc tgccactgcg cgcccggccg ccggcgctga cccggaacat ggccctgccg       720
     ctggccgcgc agtgcgtgct gcgcgaaatg ttcggccagt tcaccagcaa cctgaacacg       780
     ctgacccgct cggacgaccc cgaggtggtg caccaggccc gcgtcggctg gcggcgtttc       840
     aggagtgcgt ggcggctgtt ccagcccgcg ctggcagcgc atgcggcggc gcccgcctgg       900
     cagtcgctgg agccgctgct gatgttcgtg ggcgagttgc gcgaccttga cgtggccctg       960
     aacgacaccc tgccgccgct cgcggccgcc tacaccgcag gcaacgcgca gcgcgaagag      1020
     aaatggcagg cgatgctcca ggccctgacg caggccgccc tgctgcagcg caagtccgtg      1080
     cgccatgcgc tgcaaacgcc tgccgtcggc gcgacactgc tggccatcac gcaatggctg      1140
     gaagaactgc ctgcaagcaa ggggccggac gatgcaaaag ccgggccgga catctccctg      1200
     cgccgctggg ccaggcagcg catcacgcga cagcacaaaa agatgaagca agccctcaag      1260
     gacaccgccc atccggagag ccagcaccgc gcgcggattc tctcgaagcg gctgcgctac      1320
     ggcatcgaag ccctgcgtcc cctgctgccc cggcggcaag ccgagcgctg gcacgccaag      1380
     gcgaccgcgc tgcagaccgg catcggggcg acgcgcgaca tcatgcaggc gggggtgctg      1440
     gcggtccgct tcgaagccga cccgggactg gccgaattcc tgcgcggcgt ggccgccggt      1500
     cagccagtcc cgcgctga                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page