(data stored in ACNUC7421 zone)

EMBL: CP000529.PE88

CP000529.PE88        Location/Qualifiers
FT   CDS_pept        complement(92109..93173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0090"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: rso:RSp1044 probable
FT                   cobalt-nickel-resistance system transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35415"
FT                   /db_xref="GOA:A1VID7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1VID7"
FT                   /protein_id="ABM35415.1"
FT                   /translation="MSLRSAFPALASALLFGASTPLAKLLAGNMPPLLLAGLLYLGSGL
FT                   GLGMLLLLRRLRERLRGQPVTRLHIARAELPWLLGAIVAGGLLGPALFMLGLAQTSAAS
FT                   ASLLLNLEGMLTAVIAWLAFRENADRRIVLGMLAIALGGVLLSWEPGGATFSPGSLLIA
FT                   GACLCWALDNNLTRKVSANDALLLACLKGLLAGMGNTAIALYGGAVLPAAPALGYAGVV
FT                   GFLGYGLSLSLFVVALRTLGSARTGAYFSVAPLFGVLVSLAIWPDMPGLLFWTAAALMG
FT                   FGVWLHLSERHAHAHTHEPLRHSHAHRHDAHHRHAHDFAWDEKSPHAHEHQHEALTHSH
FT                   AHYPDIHHRHPHPH"
     atgtcgcttc gttccgcctt tcccgccctt gcctcggcgc tgctcttcgg cgccagcacg        60
     cccctggcca agctgctggc cggcaacatg ccacccttgc tgctggccgg cctgctctac       120
     ctgggcagcg gcctgggact gggcatgctg ctgctgttgc ggcgcctgcg cgagcgcctt       180
     cgcggccagc cggtcacgcg gctgcacatt gcgcgcgccg agctgccctg gctgctgggc       240
     gccatcgtcg cgggcggcct gctggggccg gcgctgttca tgctcggcct ggcgcagacg       300
     agcgccgcat cagcgtcgct gctgctgaac ctcgaaggca tgctgacggc ggtcattgcc       360
     tggctggctt tccgggaaaa cgccgaccgc cgcatcgtcc tgggcatgct ggcgattgcg       420
     ctgggcggcg tgctgctgtc ctgggagccg ggcggcgcga cgttctcgcc cggctccctg       480
     ctgatcgccg gcgcctgcct gtgctgggcg ttggacaaca acctgacgcg caaggtgtcg       540
     gccaatgacg cgctgctgct ggcctgcctc aagggcctgc tggccggcat gggcaacacc       600
     gccatcgccc tgtacggcgg cgcggtgctg ccggccgcgc cggccctggg ctatgccggc       660
     gtcgtgggtt tcctgggcta cgggctgagc ctgagcctgt tcgtggtggc gctgcgaacg       720
     ctgggcagcg cgcgcaccgg cgcctacttt tcggtcgcgc ctttgttcgg cgtgctggtt       780
     tcgctggcca tctggcccga catgccgggc ctgctgttct ggacagcggc ggcgctgatg       840
     ggctttggcg tctggctgca cctgagcgag cggcatgcgc atgcgcacac gcacgagccg       900
     ctgcggcaca gccatgcgca ccggcacgac gcgcatcacc ggcatgcgca tgatttcgcc       960
     tgggatgaaa aatcgccgca tgcgcatgaa caccagcacg aggcgctgac ccacagccac      1020
     gcccactacc cggacattca ccaccggcat ccgcacccgc attga                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page