(data stored in ACNUC7421 zone)

EMBL: CP000529.PE94

CP000529.PE94        Location/Qualifiers
FT   CDS_pept        99880..101130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0096"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   pol:Bpro_0150 extracellular ligand-binding receptor; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35421"
FT                   /db_xref="GOA:A1VIE3"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIE3"
FT                   /protein_id="ABM35421.1"
FT                   /translation="MAYLSFTGLRAATGIAAAMAAMLAFSLPASAQEDPSAAKSAPAHT
FT                   LKIGVIGPFTGASADFGIPMLNGIQQAVDEINAGGGYLGRKIEIVRKDDQANPDVGLKL
FT                   SQELVAEKVAATIGFCNTGVAAKSLEVYQTHQLPLIIPCATGTPLTAKYPGPASYIFRT
FT                   SPSDGIQAPFVVEDIVKRGWDKVAIFADTTGYGEAGLKDVEAALAARQLKPVHVARFEL
FT                   GVKDLGEPLKAARAAGANVVFSYTVGPENAVIARGRQALGWKVPQVGAWTLSFPFFIEG
FT                   GKEATEGALMAQSFIAEPSNERRASFLTSYARKYKVRKIPVPMAAAQGYDAVYVLVHSL
FT                   FGIRDGKLTGPAIKAALESKNRPYYGVIATYEQPFSKQDKEATTQNMLVMGMVKDGAVT
FT                   FAYPEDAKRNLFVQRKQ"
     atggcctatt tgagcttcac cggcctgcgc gccgcaaccg gcattgctgc cgccatggcc        60
     gccatgcttg ctttttcgct gccagccagc gcgcaggaag acccgtcggc ggcaaaaagc       120
     gccccggccc ataccctgaa aatcggcgtc atcggtcctt tcacgggggc gtcggcagac       180
     tttggcatcc cgatgctcaa cggcatccag caggccgtgg acgaaatcaa cgccggcggc       240
     ggctacctgg gccgcaagat agaaatcgtg cgcaaggacg accaggccaa tcccgatgtc       300
     ggcctgaagc tgtcgcagga actggtggcc gaaaaggttg ccgccaccat cggtttttgc       360
     aacaccggcg tcgccgccaa atcgctggag gtgtaccaga cccaccagtt gccgctgatc       420
     attccttgcg ccaccggcac gccgctcacg gccaaatacc cgggtccggc aagctacatc       480
     tttcgcacct cgcccagtga cggcatccag gcgccgttcg tggtcgaaga cattgtcaag       540
     cgcggctggg acaaggtcgc catatttgcc gacaccaccg gctatggcga agcgggcctg       600
     aaggacgttg aagccgcact ggccgccagg cagctcaagc cggtgcatgt ggcgcggttt       660
     gagctgggcg tgaaagacct gggcgagcca ctgaaggcgg ccagggctgc cggcgccaac       720
     gtggtgttca gctacacggt cgggcctgaa aacgccgtga tcgcgcgcgg gcgccaggcg       780
     ctgggctgga aggtgccgca ggtcggcgcc tggacgctgt cctttccctt cttcattgaa       840
     ggcggcaagg aagccaccga gggcgcgctg atggcgcaga gcttcattgc cgagcccagc       900
     aacgagcgcc gtgcgtcctt tctgaccagc tatgcgcgca agtacaaggt caggaaaatc       960
     ccggtcccga tggccgccgc gcagggctat gacgcggtct acgttctggt gcattcgctg      1020
     ttcggcatac gcgacggcaa actcaccggc ccggccatca aggcggcgct cgaaagcaaa      1080
     aaccgccctt actacggcgt catcgccacc tacgagcagc ctttcagcaa gcaggacaag      1140
     gaagccacga cgcaaaacat gctggtcatg ggcatggtga aagatggcgc ggtgaccttt      1200
     gcctatcccg aggacgccaa gcgcaacctg tttgtccagc gcaagcagta a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page