(data stored in ACNUC7421 zone)

EMBL: CP000529.PE96

CP000529.PE96        Location/Qualifiers
FT   CDS_pept        complement(105043..105465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0098"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: rfr:Rfer_0401 UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35423"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIE5"
FT                   /protein_id="ABM35423.1"
FT                   /translation="MKILLAVDGSSYTKKMLAYLVTHDALFDAKNEYAVLTVQPALPPH
FT                   ARAAVGKEIVDSYYAEETGKVMAPVAEFLKHHGIIAKSDWKVGPAGETIAKFADEGKFD
FT                   LLIMGSHGHGALGNLIMGSVTTQVLAHSKVPVLLVR"
     atgaagattc ttctggccgt tgacggcagc agctacacca aaaaaatgct ggcctacctg        60
     gtcacgcatg acgcgctgtt tgatgccaag aatgagtacg ccgttctcac ggtgcagccc       120
     gccttgcctc cacacgcacg cgcggccgtg ggcaaggaaa tcgtggacag ctattacgcc       180
     gaggaaaccg gcaaggtcat ggcgccggtg gccgaattcc tcaagcacca cggcatcatt       240
     gccaaaagcg actggaaggt gggtccggcc ggcgaaacca ttgccaaatt tgccgacgag       300
     ggcaagttcg atctgctgat catgggctcg cacggccatg gcgcgctcgg caacctgatc       360
     atgggctcgg tgaccaccca ggttctggcg cacagcaagg tgccggtgct gctggttcgc       420
     tag                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page