(data stored in ACNUC7421 zone)

EMBL: CP000529.PE98

CP000529.PE98        Location/Qualifiers
FT   CDS_pept        complement(106815..107771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0100"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pol:Bpro_0158 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35425"
FT                   /db_xref="GOA:A1VIE7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIE7"
FT                   /protein_id="ABM35425.1"
FT                   /translation="MTPPNFRTLDLNLLRVFDEVMAERSLTRAARNLSLTQPAVSNALR
FT                   RLRETLGDDLVQRSGQGMAPTPRAVVIWPAVREALRQLQASLIPNEFVAAEATTAFVLA
FT                   MADATAAELIPGLSEILEREARGVSIRVLPLTTRDPRRMLDEQACDLAVGYFPSVVPDL
FT                   TAKEQNGEAMPFFFQRLYDGEYVCVMRKDHPLAGGVLSLDDFCNARHMLVSFSGRPYGF
FT                   IDESLAALGRERRVVLTVNQFFTAGQVVAHSNLLTVLPRHFVRVTGIAEQLALQTLPFA
FT                   VSPVHVDSLWHRRSEQRSAHVWLRQAILRAAEKAFSI"
     gtgacccctc ccaatttccg caccctggac ctcaacctgc tgcgtgtttt tgacgaggtc        60
     atggccgagc gcagcctcac gcgggcggcg cgcaacctgt cgctgacgca gccggccgtc       120
     agcaatgccc tgcgccggct gcgcgagacg ctgggcgacg atctggtgca gcgcagcggc       180
     cagggcatgg cgcccacgcc acgcgcggtg gtgatctggc cggccgtgcg cgaggccctg       240
     cggcagctgc aggcgtcgct gattcccaac gagttcgttg ccgccgaggc gacgaccgcc       300
     tttgtgctgg ccatggccga cgcgacggcg gccgaactga tcccgggcct gagtgaaatc       360
     ctggagcgcg aagcccgggg cgtgagcatc cgggtgctgc cgctgaccac gcgcgacccc       420
     aggcggatgc tcgacgagca agcctgcgat ctggcggtcg gctatttccc gtcggtggtg       480
     cccgacctga cggccaagga gcagaacggc gaggcgatgc cgtttttctt ccagcggctg       540
     tacgatggcg aatatgtctg cgtgatgcgc aaggaccatc cgctggctgg cggcgtgctg       600
     agcctggacg acttttgcaa cgcccgccac atgctggtga gtttttccgg ccggccttac       660
     gggttcatcg acgaatcgct ggccgcgctc ggccgggagc ggcgggtggt gctgacggtg       720
     aaccagttct tcaccgccgg ccaggtggtg gcccattcca acctgctgac cgtgctgcca       780
     cggcattttg tacgggtgac cggcattgcc gagcaactgg cgctgcagac cctgccgttt       840
     gccgtgtcgc cggtgcatgt cgattcgcta tggcaccgtc gctccgagca gcgcagcgcg       900
     catgtctggc tgcgccaggc gatcctgcgg gcggccgaaa aggctttttc gatctga          957
//

If you have problems or comments...

PBIL Back to PBIL home page