(data stored in ACNUC30630 zone)

EMBL: CP000580.PE108

CP000580.PE108       Location/Qualifiers
FT   CDS_pept        115779..116999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0108"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0118 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95921"
FT                   /protein_id="ABN95921.1"
FT                   /translation="MAEPNSPVNKPRTPPYKIAGLVLLVIFAVVATLVAFQFRGDFASR
FT                   EKLTMMAARAGLNLDPGTKVTYNGVEIGRVAEVNAVSVGNDPRARITLEVDTKYMQLIP
FT                   ANVLADISATTVFGNKYVSFTTPPDPVPQRIKSTDVIDVTSVTTEFNTLFETVVSVAEK
FT                   VDPVKLNQTLTATAQALDGLGDRFGESIVNGNAILADLNPQMPQIRRDVRGLADLGEVY
FT                   ANAAPDLFDGLENAVTTARTLNEQRGNLDQALIAAVGFGNTGGEVFERGGPYLVRGAED
FT                   LIPTSALLDEYSPALFCTIRNFHDVEPKISSSLGGNGYSLNTHSEALGAGNPYVYPDNL
FT                   PRVNAKGGPEGRPGCWQPITRDLWPAPYLVLDTGASLAPYNHLELGQPIAIEYVWGRQI
FT                   GENTINP"
     atggccgagc cgaactcacc cgtcaacaag ccgcgtacgc cgccgtacaa gatcgcgggc        60
     ctcgtcctgc tggtgatctt cgcggtggtc gccacgctgg tcgcgtttca gttccgcggc       120
     gacttcgctt cgcgcgagaa gctgaccatg atggccgccc gcgccggcct gaacctcgac       180
     cccggcacca aggtcaccta caacggtgtg gagatcggcc gcgtcgccga ggtcaacgcg       240
     gtcagcgtcg gcaacgatcc ccgggccagg atcacgctcg aggtcgacac gaagtacatg       300
     cagctgatcc cggcgaacgt gcttgcggac atctcggcga ccacggtgtt cggcaacaag       360
     tacgtctcgt tcaccacgcc gcccgacccg gtcccgcagc ggatcaagtc caccgacgtc       420
     atcgacgtga ccagcgtgac gacggagttc aacacgctgt tcgagaccgt cgtgtcggtg       480
     gcggagaagg tggacccggt caagctgaac cagaccctga ccgcgaccgc gcaggccctg       540
     gacggcctcg gcgaccgctt cggcgagtcg atcgtcaacg gcaacgcgat cctggccgac       600
     ctcaacccgc agatgccgca gatccgacgg gacgtccgcg ggctggccga cctcggcgag       660
     gtgtacgcca acgccgcccc cgatctgttc gacgggctgg agaatgcggt gaccacggcc       720
     cgcacgctca acgaacagcg cggcaacctc gatcaggcgc tcatcgcggc ggtcggcttc       780
     ggcaacaccg gcggtgaggt gttcgaacgt ggtggtccct acctggtccg cggtgcggag       840
     gacctcatcc cgacgagtgc gctgctcgac gagtacagcc ccgcgctgtt ctgcacgatc       900
     cgcaacttcc acgacgtgga gccgaagatc tcgtcgtcgc tgggcgggaa cggctattcg       960
     ctcaacaccc actccgaggc cctcggcgcg ggcaacccgt acgtgtaccc ggacaacctg      1020
     ccgcgcgtga acgccaaggg tggtccggag gggcggcccg gctgctggca gcccatcacc      1080
     cgggatctgt ggcccgcgcc gtacctggtc ctcgacacag gcgcctccct tgcgccgtac      1140
     aaccatctcg aactcggtca accgatcgcc atcgaatacg tctggggacg ccagatcggg      1200
     gagaacacga tcaacccatg a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page