(data stored in ACNUC30630 zone)

EMBL: CP000580.PE11

CP000580.PE11        Location/Qualifiers
FT   CDS_pept        complement(13347..13766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95824"
FT                   /protein_id="ABN95824.1"
FT                   /translation="MQQTEWSPPAAGIAGCGFAGLLMAIAAVTVVTDPPGRLLAGIAAV
FT                   GLITFAIMSWRARPKLAITPEGVAVRGWWHTRVLRQADIKIVRITEFRRLARKMRLLEI
FT                   DTADDRLHVFTRWDLGTDPVDVLDALTAAGYTGTQ"
     atgcagcaaa ctgaatggag tccgcccgcg gctggaatcg caggttgcgg cttcgcgggt        60
     ctgttgatgg caatcgcggc tgtgactgtc gtcacagacc ctccgggcag gcttctcgcc       120
     ggcattgccg cagtgggatt gatcacattt gcaatcatgt cgtggcgtgc ccggccgaag       180
     ctggcaatca cccccgaggg ggtggcggtg cgcggctggt ggcacacccg ggtgctgagg       240
     caggccgaca tcaagatcgt gcggatcacc gagttccggc gcctggcccg caagatgcgg       300
     ctactagaga tcgacacagc cgatgaccgg ctgcacgtgt tcacgcggtg ggatctgggg       360
     actgaccccg tcgacgtgct cgatgcgctc actgcggccg gctacaccgg cacgcagtga       420
//

If you have problems or comments...

PBIL Back to PBIL home page