(data stored in ACNUC30630 zone)

EMBL: CP000580.PE111

CP000580.PE111       Location/Qualifiers
FT   CDS_pept        119625..121271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0111"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0121 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95924"
FT                   /protein_id="ABN95924.1"
FT                   /translation="MSTIFNVRNMKMPTLSRASVIIGTLVVVLALVAAFAGWQLYKRLS
FT                   TNTVVAYFSDTLALYPGDKVQIMGVRVGTIDKIEPAGDKMKVTFSYESKYKVPANATAS
FT                   ILNPSLVASRTIQLAPPYTGGPVMEDDAVIPIDRTQVPVEYDELRDSLDRILTDLGPTP
FT                   DQPKGPFGDVIESFADGLSGKGKQINTTLNSLSEALTTLNEGRGDFFSVVKSLALFVNA
FT                   LYRSDQQFVALNDDLAQFTNSFTNTDRELATALQDLNELLTTTRGFLDENSEVLTKDIN
FT                   NLADVTNAILQPEPLDGLETGLHVLPNLGGNILNISSPVNGGIVGVPVINGMANPMQFI
FT                   CSSIQAGSRLGYQESAELCAQYLAPILDALKFNFPPFGLNQISTAMTLPKMIAYSEDRL
FT                   RPPPGYKDTTVPGIFSRDTLFSHGNHEPGWVVAPGMQGVDVQPFTANMLTPQSLAALLG
FT                   GPDAPIPGAPPAFGTTRDGNLPGPPNAFDERNPLPPPWYPQPGPPPAPAPGVIPGDPGG
FT                   SPLSGPAPGPAPAAQAPAPAGPPLPAEAGAP"
     atgtcaacga tcttcaacgt gcggaacatg aagatgccga cgttgtcacg cgcttcggtg        60
     atcatcggca cgcttgtcgt ggtgctggcg ctggtggccg cgttcgcggg ctggcagctg       120
     tacaagaggc tgtccacgaa caccgtcgtg gcgtacttct ccgacaccct ggcgctgtac       180
     cccggcgaca aggtgcagat catgggtgtg cgggtcggca cgatcgacaa gatcgaaccg       240
     gcgggcgaca agatgaaggt gaccttcagc tacgagtcga agtacaaggt gcccgcgaac       300
     gccaccgcgt cgatcctcaa cccgagcctg gtggcctcgc gcaccattca gctggccccg       360
     ccgtacaccg gcggcccggt catggaggat gacgcggtca tcccgatcga ccgcacccag       420
     gtgcccgtcg agtacgacga gctgcgtgac tcgctcgacc gcatcctcac cgacctcggc       480
     cccacgccgg accagcccaa gggtccgttc ggtgacgtga tcgagtcctt cgccgacggt       540
     ctgtccggca agggaaagca gatcaacacg acgttgaaca gcctctcgga ggcgctgacc       600
     accctcaacg agggccgcgg tgacttcttc agcgtggtca agagcctcgc gttgttcgtc       660
     aacgcgctct accgcagcga tcagcagttc gtcgccctca atgacgacct ggcgcagttc       720
     accaactcgt tcaccaacac cgaccgcgag ctggcgaccg cgctgcagga cctcaacgag       780
     ctgctcacca ccacgcgcgg gttcctcgac gagaacagtg aggtcctgac caaggacatc       840
     aacaacctcg ccgacgtgac caacgcgatc ctgcagcccg aaccgctcga cggtctggaa       900
     acgggtctgc acgtgttacc gaacctgggc ggcaacatcc tcaacatcag ctcaccggtc       960
     aacggcggca tcgtcggtgt gccggtcatc aacggcatgg ccaacccgat gcagttcatc      1020
     tgcagttcga tccaggcggg cagccggctg ggctaccagg agtcggcgga actgtgcgcg      1080
     cagtacctgg cgccgatcct cgatgcgctg aagttcaact tcccgccgtt cgggttgaac      1140
     cagatcagca cggccatgac gttgccgaag atgatcgcct actccgagga ccggctgcgc      1200
     ccgccgccgg gatacaagga caccacggtg cccggcatct tctcccgcga cacgttgttc      1260
     tcccacggca accacgagcc cggctgggtc gtcgccccgg ggatgcaggg cgtcgacgtg      1320
     cagccgttca ccgcgaacat gctgacgccg cagtcgctgg ccgcgctgct cggcggaccc      1380
     gacgcgccga tcccgggtgc accgcccgcg ttcggcacca cgcgcgacgg caacctgccc      1440
     ggcccgccga acgccttcga cgaacgcaat ccgttgccgc cgccgtggta cccgcaaccc      1500
     ggcccgccgc ccgcacccgc cccgggtgtc atcccgggcg accccggggg ctccccgctg      1560
     tcgggtccgg cgccaggacc cgcgcccgcc gcgcaggcac ccgcaccggc aggcccgccg      1620
     ttgcccgctg aagcaggagc gccgtga                                          1647
//

If you have problems or comments...

PBIL Back to PBIL home page