(data stored in ACNUC30630 zone)

EMBL: CP000580.PE114

CP000580.PE114       Location/Qualifiers
FT   CDS_pept        123952..124623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0114"
FT                   /product="putative conserved MCE associated membrane
FT                   protein"
FT                   /note="KEGG: mmc:Mmcs_0124 putative conserved MCE
FT                   associated membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95927"
FT                   /protein_id="ABN95927.1"
FT                   /translation="MEGDAGTRQLNPTDAEETPDKSVAVSGDNPDDTESPAEDGILGER
FT                   VTTVPSEDDGRRPPRLGRGWLTAICAVLLLLGAGAGVGGYLALRSHEESTQLAENEAAA
FT                   VAAARDCVAATHAPDAAAMTESQAKILECSTGDFGVQAGLYGGLLVDAYRAANVQVQVS
FT                   DMRAAVEKHNADGSIDVLVAVRVKVTNSEAADQEQGYRLRVQMAPDEGTYKVARLDQVT
FT                   S"
     atggaaggag atgctggcac ccgccagctg aaccccaccg atgctgagga aacgccggac        60
     aagtcggtag cagtatccgg agacaatcca gacgacactg aatcccccgc cgaggacggc       120
     atcctgggcg agcgggtgac cacggtgccg tcggaggacg acgggcgtcg tccgccgcgg       180
     ctcggccgcg gctggctgac cgcgatctgc gccgtcctgc tgctgctcgg cgcgggcgcc       240
     ggcgtgggcg gatacctggc gttgcggtcc cacgaggaga gcacgcaact cgcggagaac       300
     gaggccgccg cggtggcggc cgcgcgggat tgcgtggcgg ccacccacgc cccggatgcg       360
     gcggcgatga ccgagagcca ggccaagatc ctggagtgct cgacgggcga cttcggcgtg       420
     caggccgggt tgtacggcgg cctgctcgtc gacgcctacc gcgccgccaa cgtgcaggtg       480
     caggtgtcgg atatgcgcgc ggcggtggag aaacacaacg ccgacgggtc catcgacgtc       540
     ctggtcgcgg tgcgggtgaa ggtgaccaac tccgaggccg ccgatcagga acagggatac       600
     cgcctgcggg tccagatggc acccgacgag ggcacctaca aggtcgcccg actcgaccag       660
     gtgacttcgt ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page