(data stored in ACNUC30630 zone)

EMBL: CP000580.PE120

CP000580.PE120       Location/Qualifiers
FT   CDS_pept        128884..131172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0120"
FT                   /product="AAA ATPase containing von Willebrand factor type
FT                   A (vWA) domain-like protein"
FT                   /note="KEGG: mmc:Mmcs_0130 AAA ATPase containing von
FT                   Willebrand factor type A (vWA) domain-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95933"
FT                   /protein_id="ABN95933.1"
FT                   /translation="MAKHRGAKRRSKKIAALGAVTVTATALTVGAAPAPQASAAAARST
FT                   DRVDLTADFRLFPPPQAIPDLTGGAGEAAYDLKNEFADFVFRSIFENLNLAAFAQAAGV
FT                   DPQSILERVLDNLPLALLTDPIFVDLLGGITLPLAAALGALPVLNQIPLLRDLLTQGLN
FT                   VAGLNTISGLLDILGLDLSNLADLTGLGERVGVNLVTSGDVFTLLKVLGTDLGWVPTLP
FT                   NSVADDVNETEYLGIGVDGVLDLVDTGIINVPGLLNQLLDLLNLNTDQIPDVLKVRAPV
FT                   VIGEGVGAFAAGMAYQDILAQLPNQPGGANYNGVEADPLLGSVTVLPMLLLRNPGRANG
FT                   GLFARLYPLAGLFGIDTVTPDTEVSNSGGVRLPGGLYVGGATLIPVKIDVTLQHDWLSD
FT                   VPAWPNPFSLLNTLTAVVAPTYILRGLDTGLVAGAVAGQLGPQIGEVVGGIAEDDPLAL
FT                   DFYVTVPIDALPLLEPTYLFFDAINLLTGANLNNPIGTALGPALSSLVNLGYTDVVRQW
FT                   NDDGDYWEYVRTFDDTDVPTAFGSFPDINWMNVPGDIAGAFAAGVRQAFEDGLVNRDGP
FT                   VKNALATLLNLIGLDNGLPGGIGGAGLNGVLDQIRDTIDDVLGGLDLPRPSTAAVNSVP
FT                   DDASPRIALRTVGGEDTPAEEADDDTRDHVEDVPVADTDTDGDAETDTDIDTGTDTENE
FT                   PVDEPEDQLEEDETTDERETTVEDEDASEAEASEAEPADTEDTADTKDTGDTKDTGDTG
FT                   ESGAGEKAA"
     atggccaagc atcgcggtgc gaagcggcgt tcgaagaaga ttgctgcact cggcgcggtc        60
     accgtcaccg cgacggcgct gaccgtcggc gccgctcccg cgccccaggc ttcggccgcg       120
     gctgccaggt ccaccgatcg cgtcgacctc accgccgact tccggctctt cccgcccccg       180
     caagcaatcc cggacctcac cgggggcgcc ggtgaggccg cctacgacct caagaacgaa       240
     ttcgccgatt tcgtcttccg ctcgatcttc gagaatctga acctcgcggc attcgcgcag       300
     gcggcggggg tcgatccgca gagcatcctc gagcgggtgc tggacaacct gccgctggcg       360
     ctgctgaccg acccgatctt cgtcgacctc ctcggcggca tcacgctccc cctcgccgcg       420
     gcgctcggcg cgctcccggt cctcaaccag atcccgttgt tgcgggacct gttgacccag       480
     ggcctcaacg tcgccggcct gaacaccatt tccgggctgc tcgacatcct cggcctcgac       540
     ctcagcaatt tggccgacct gacggggctg ggcgagcggg tgggcgtgaa cctcgtgacc       600
     tccggcgacg tgttcacgct gctcaaggtg ctgggcaccg acctcggctg ggtgccgacg       660
     ctgcccaact ccgtggccga tgacgtcaac gagaccgagt acctcggcat cggagtggac       720
     ggtgtgctcg acctggtgga caccggcatc atcaacgtcc cgggcctcct caaccagctt       780
     ctcgacctgc tcaacctcaa cacggaccag atcccggacg tgctcaaggt ccgggcgcct       840
     gtggtcatcg gcgagggtgt cggggcgttc gcggccggca tggcgtacca ggacatcctc       900
     gcccagctgc ccaatcagcc gggcggcgcg aactacaacg gcgtcgaggc cgacccgctg       960
     ctgggcagcg tgacggtgct gccgatgttg ttgctgcgca accccggtcg cgcgaacggc      1020
     ggcctgttcg cccgcctgta cccactggcc gggctattcg ggatcgatac ggtgaccccg      1080
     gataccgagg tgagcaacag cggcggcgtg cggctccccg gcggcctgta tgtcggtggg      1140
     gcgacgctga tcccggtcaa gatcgacgtc acgctgcagc acgactggct ctccgacgtc      1200
     cccgcgtggc ccaacccgtt ctcgctgctg aacaccctca cggcggtcgt cgcaccgacg      1260
     tacatcctgc ggggcctgga tacgggtctg gtggcgggtg cggtggcggg gcaactgggg      1320
     ccccagatcg gggaggtcgt cggcggcatt gccgaggatg acccgttggc gctcgacttc      1380
     tacgtgacgg tcccgatcga cgcactgccg ctgctcgagc ccacctatct ctttttcgac      1440
     gccatcaacc tgctgacggg cgccaacctg aacaatccca tcggcaccgc gctcggtccg      1500
     gccctgagca gcctggtcaa cctcggctac accgacgtgg tgcggcagtg gaacgacgac      1560
     ggcgactact gggagtacgt ccgcaccttc gacgacaccg acgtgccgac ggcgttcggc      1620
     tcgttccccg acatcaactg gatgaacgtg ccgggcgaca tcgcgggcgc gttcgccgcc      1680
     ggcgtccggc aggcgttcga ggacggtctg gtcaaccgcg acggcccggt caagaacgcg      1740
     ctggcgacgc tgctgaacct gatcggcctc gacaacggtc tgcccggcgg tatcggcggt      1800
     gcgggcctca acggagtcct cgaccagatc cgcgacacga tcgacgatgt gctcggcggc      1860
     ctggatctgc cccggccgtc gacggccgca gtcaattccg tgcccgacga cgcttcgccc      1920
     cggatagcgc tgaggaccgt cggcggcgag gacacccccg ccgaggaagc ggacgacgac      1980
     accagggacc acgtcgagga tgtgccggtc gccgatacgg acaccgatgg cgacgcagag      2040
     accgatacgg acatcgacac cggcactgac acggagaacg agcccgtcga cgagccggaa      2100
     gaccagctcg aggaagacga gaccacggac gagcgcgaga ccacggtcga ggacgaagac      2160
     gcatccgagg ccgaagcatc cgaggccgaa cccgccgata ccgaggacac cgccgacacc      2220
     aaggacaccg gcgacaccaa ggacaccggc gacaccggcg agagcggcgc gggcgagaag      2280
     gccgcctga                                                              2289
//

If you have problems or comments...

PBIL Back to PBIL home page