(data stored in ACNUC30630 zone)

EMBL: CP000580.PE131

CP000580.PE131       Location/Qualifiers
FT   CDS_pept        141757..142770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0131"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: mmc:Mmcs_0141 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95944"
FT                   /protein_id="ABN95944.1"
FT                   /translation="MKAVVRLAASCVTAALLVAGCGSDDKAADETAPAQTGWVDDEVTF
FT                   TADGLTIHGTYRHRDGSGPATLLISESGQTDRNGDNAVAGPVGNMRQLAELLSERDVAS
FT                   LRYDKVGTGRTGLGPYATRPADVGTAVYTTGAAAALRFLADQPDTARDRISVYALGEGT
FT                   VHAMSLAAANDPAVHSLALLQPLAARYLDIITGRVRAEADPTVLANWLAAVEEIRTKGT
FT                   VPAQLPEGLGAIVNPGNIKAVIEADRVDPLALAAKVPAGTPVLLTCSNSDGQAKCDALR
FT                   PLMDALRHTELTVVELDGVNHVLRDDPTDNVANYAQQTPLSPQVVKALDEFVGEQP"
     gtgaaagccg ttgtgcgact ggctgcctcg tgtgtaacgg ccgcgctgct ggtcgccggg        60
     tgcggctcgg acgacaaggc cgcggacgag accgcacccg cccagacggg ctgggtcgac       120
     gacgaggtga cgttcaccgc cgacggtctg accatccacg gcacctaccg ccaccgtgac       180
     ggctccggcc ccgccacgct gctgatctcc gagagcggtc agaccgaccg caacggcgac       240
     aacgcggtgg cgggtccggt cggcaacatg cgccaactcg ccgaactgct ctccgaacgc       300
     gacgtcgcca gcctgcgcta tgacaaggtg ggcaccggac ggaccggcct cggcccgtac       360
     gccaccagac cggccgacgt cggcaccgcg gtatacacca ccggcgcggc cgccgcgctg       420
     cggttcctcg ccgaccaacc ggacaccgcg cgcgaccgga tctccgtcta cgccctcggc       480
     gagggcaccg tccacgccat gtcgctggcg gccgcgaacg atccggcggt gcactcactg       540
     gcgctgctgc aaccgctggc cgcccgctat ctcgacatca tcaccggacg cgtccgcgcc       600
     gaagccgatc cgaccgtgct ggccaactgg ctggctgccg tcgaggagat ccgcaccaag       660
     ggcaccgtgc ccgcccagct gcccgaaggt ctcggcgcca tcgtcaaccc gggcaacatc       720
     aaggccgtca tcgaggccga ccgggtcgat cccctggcgc tggccgcgaa ggtgcccgcg       780
     ggtacgccgg tgctgttgac gtgttcgaac tccgacgggc aggccaagtg cgatgcactg       840
     cggccgttga tggacgcgct gcggcacacc gagctgaccg tcgtcgaact cgacggcgtc       900
     aaccacgtgc tccgcgacga cccgaccgac aacgtcgcga actacgctca acagacgccg       960
     ctttctccac aggtggtgaa ggcgctggac gaatttgtcg gcgagcagcc ctaa            1014
//

If you have problems or comments...

PBIL Back to PBIL home page