(data stored in ACNUC30630 zone)

EMBL: CP000580.PE133

CP000580.PE133       Location/Qualifiers
FT   CDS_pept        143527..144042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95946"
FT                   /protein_id="ABN95946.1"
FT                   /translation="MSGRDTQRAKVYAAEQFVRTLFDRAAERGNRIVEFFGTQLTLPPE
FT                   ARFASVASVQAYVDDVLAHPRIRTGWPGAGALTVRSRRGATAAHYEVIDGRAVIAVPER
FT                   HTTWALRELVVLHEIAHHLSHAEPAHGPAFVSTFCEVAEAVMGPEVAHVLRVVYAKEGV
FT                   RLGGGSRG"
     gtgagcggcc gggacaccca gcgcgcgaag gtctacgcgg ccgagcagtt cgtgcgcacc        60
     ctgttcgatc gggcagccga acgcggcaac cggatcgtcg agttcttcgg cacccagctg       120
     acgctgccgc cggaggcgcg cttcgcgtcg gtggcgtcgg tgcaggccta cgtcgacgac       180
     gtcctggccc acccgcggat ccggaccggc tggcccggcg ccggtgcgct cacggtccgc       240
     tcgcgtcgcg gcgccaccgc cgcacactat gaggtcatcg acggccgggc ggtcatcgcg       300
     gtgcccgaac ggcacaccac ctgggcactg cgggagctgg tggtgttgca cgagatcgcc       360
     caccacctca gccatgcgga gcccgcgcac ggcccggcgt tcgtgtccac gttctgcgag       420
     gtcgctgagg ccgtgatggg tccggaggtc gcccacgtac tgcgggtggt ctacgccaag       480
     gagggggtcc gcctgggtgg cggttccagg ggttaa                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page